SecReT4
Protein ID: 319778327
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0141
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]148697..149509 [+]
ProductConjugal transfer-like protein
Component typeVirB9
UniProt IDE8UDI9
KEGG IDteq:TEQUI_0141
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.9e-62, Aligned region: 31..244
Protein Sequence: 270 a.a.     [Download]
>gi|319778327|ref|YP_004129240.1| Conjugal transfer-like protein [Taylorella equigenitalis MCE9]
MKYFLSTFVAFILLIAGNAYALVIPQGGKGDGRIQTAFYTPTQVYNIKASIGRAVLIQFEEDEYLDEEMG
LLGMGDATAWNVAVKANNVLFKPLSENPDTNLIVNTNKRTYAFELSVLPKGKQMDTYVLRFTYPKKQMIS
RDEELRDQVSKEFANKSVNVKRMNQNYWGYGDDELAPTALYDDGRFTYFEFDNNKDLPNIYKIMPDGTEM
LLNFTVKGNTLIVHQLNKEFYLRLGTKVLGIVNKGFDVNGRFNYHGTGNETDVRVLREKN
 
Nucleotide Sequence: 813 bp     [Download]
>gi|319778189|ref|NC_014914.1|:148697-149509 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAAATACTTTTTATCCACTTTTGTAGCGTTTATTTTGCTTATAGCAGGCAATGCATACGCATTAGTTA
TACCGCAAGGCGGTAAGGGTGATGGGCGTATCCAAACGGCGTTTTACACCCCTACTCAAGTTTATAACAT
AAAAGCTAGTATTGGACGTGCGGTGCTTATTCAGTTTGAAGAAGATGAGTACTTAGATGAGGAAATGGGA
TTATTAGGTATGGGAGACGCTACTGCTTGGAACGTGGCAGTAAAAGCAAATAATGTGTTATTTAAGCCTT
TATCAGAAAACCCAGATACTAACCTTATTGTTAATACCAATAAAAGAACATATGCGTTTGAATTAAGTGT
GTTGCCTAAGGGCAAACAGATGGATACATATGTTTTAAGGTTTACTTATCCTAAAAAACAAATGATTTCA
AGAGATGAAGAATTAAGAGATCAAGTATCTAAGGAATTTGCTAATAAATCAGTAAATGTTAAACGCATGA
ATCAAAACTATTGGGGATATGGTGATGATGAATTGGCACCTACAGCATTATACGATGATGGACGGTTTAC
GTACTTTGAATTTGATAATAATAAGGACTTACCTAATATCTACAAAATCATGCCAGATGGTACAGAAATG
CTTCTTAATTTTACGGTTAAGGGTAATACATTAATAGTTCATCAGCTAAATAAAGAGTTTTACTTACGAT
TAGGCACGAAGGTATTAGGGATTGTAAATAAAGGATTTGATGTAAACGGAAGGTTTAACTACCACGGTAC
AGGCAATGAGACTGACGTAAGAGTTCTTAGGGAGAAGAATTAA
 Primer design