SecReT4
Protein ID: 319778328
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0142
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]149510..150673 [+]
ProductBacterial conjugation TrbI-like protein
Component typeVirB10
UniProt IDE8UDJ0
KEGG IDteq:TEQUI_0142
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.8e-56, Aligned region: 203..376
Protein Sequence: 387 a.a.     [Download]
>gi|319778328|ref|YP_004129241.1| Bacterial conjugation TrbI-like protein [Taylorella equigenitalis MCE9]
MNNGFNQETNDFTLADNINDPTVERGEVDLSNSKKASSKVRKLTASLLFVAGLVILLLLLFRSNDKPKVV
NEKEPEVEVNPSRDFANDQRDILQKQLQAQRNQMKPSVKEEAKPTVIGETHTTVVVKPTEENKEEEEKDP
DLERRLSGEVLVPFDIKKQASKDSEISDRDNRGVNTESIMYNRMTRTDTHSVVATLRDDQTYLMRKGTNI
ACTLQTKIITTQPGFTQCVVNRDVYSANGEVLLIERGSMVVGEQVSQLTQGQARVFVMWNTIDTPYGVKI
EIDSPSTGPLGEAGIDSQVDTHFWKRFGGAIMLSMIDDVMVNLSNRSKNYNNFENTTEATNDMASEALQN
TIDIPPTGYVNQGTLINIIVARDVDFKPVYEVVKMKK
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|319778189|ref|NC_014914.1|:149510-150673 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAATAATGGATTTAATCAAGAAACAAATGATTTCACCCTAGCGGATAATATTAATGACCCAACTGTGG
AAAGAGGTGAAGTAGATTTAAGCAATTCTAAAAAAGCTAGTTCAAAGGTTAGAAAACTTACCGCTTCTCT
TTTGTTTGTAGCAGGCTTAGTAATATTGTTACTTTTATTATTTAGAAGCAACGATAAACCAAAAGTAGTA
AATGAGAAGGAACCTGAGGTTGAAGTCAATCCAAGCCGTGATTTTGCAAACGATCAAAGGGATATACTTC
AAAAGCAATTGCAAGCCCAAAGAAATCAAATGAAGCCCTCAGTAAAAGAGGAGGCTAAACCTACGGTAAT
CGGTGAAACACATACAACGGTTGTAGTAAAGCCAACTGAAGAGAATAAAGAGGAGGAAGAGAAAGACCCA
GATTTAGAAAGAAGGCTTTCTGGTGAAGTTTTGGTTCCCTTTGATATAAAAAAGCAAGCCTCTAAAGATA
GTGAGATTAGTGATAGAGATAATAGAGGGGTTAATACAGAAAGTATTATGTACAATAGAATGACTAGGAC
TGACACTCATAGCGTGGTAGCAACTTTAAGAGACGATCAAACGTATCTAATGAGAAAGGGTACAAATATA
GCATGCACACTTCAAACCAAAATTATTACTACACAGCCCGGTTTCACACAATGCGTTGTAAATCGTGATG
TATATAGTGCAAATGGTGAAGTCCTATTAATTGAGCGTGGTTCAATGGTTGTAGGTGAACAAGTCTCTCA
ACTAACCCAAGGGCAAGCTAGAGTATTTGTGATGTGGAACACAATCGATACACCGTATGGGGTTAAGATT
GAAATTGATAGTCCATCAACAGGACCGTTAGGAGAAGCAGGAATAGATTCTCAAGTAGATACGCATTTTT
GGAAACGCTTTGGGGGTGCAATTATGCTATCAATGATAGATGATGTAATGGTAAATCTAAGTAATAGATC
TAAAAATTACAATAATTTTGAGAATACTACAGAAGCTACAAACGATATGGCTAGTGAAGCCTTACAAAAC
ACAATCGATATACCGCCTACTGGATATGTCAATCAAGGAACACTTATAAATATTATCGTAGCCCGTGATG
TTGACTTTAAACCAGTTTATGAAGTCGTTAAGATGAAAAAGTAG
 Primer design