SecReT4
Protein ID: 319778334
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0148
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]153015..154031 [+]
ProductType II/IV secretion system protein
Component typeVirB11
UniProt IDE8UDJ6
KEGG IDteq:TEQUI_0148
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.2e-62, Aligned region: 18..314
Protein Sequence: 338 a.a.     [Download]
>gi|319778334|ref|YP_004129247.1| Type II/IV secretion system protein [Taylorella equigenitalis MCE9]
MNNKDISVRNMLDKLGLTSLLSIEGTTELMINRPFEIFCENSKGVIRYEMPNLTLARLYELANVMCVYNG
KNIIPKDPMQSVTLPDGERCHIVIPPACEDGTVVFSIRKPSVSRFSLTDYVNSNRLSGFQDVANAQRTTE
GILLHQHEQQLLQYKETQDLGSFFRLAIEKKLNICMVGGTGSGKTTFTKALADLIPLDTRIITIEDTHEL
DLPNHVNHVHLFYKENITAKSLIATCMRLKPDRILLTELRGDEAFDYLSALNTGHAGGLTSVHANDAESV
FYRITQLAKESVAGRAMDYNYLLNIVRSTIDVVCFFEKTYLTELYYDPIAKHTALKGR
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|319778189|ref|NC_014914.1|:153015-154031 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAATAATAAAGATATAAGTGTAAGAAATATGCTTGATAAGCTAGGATTGACTAGCTTATTAAGTATTG
AAGGAACGACGGAATTAATGATAAACCGCCCTTTTGAGATTTTTTGCGAAAACTCAAAAGGTGTAATTAG
GTATGAAATGCCTAATCTTACGCTAGCAAGGTTATATGAATTGGCTAATGTGATGTGTGTGTATAACGGT
AAAAACATTATTCCTAAAGATCCAATGCAAAGTGTGACTTTACCAGATGGAGAAAGATGTCATATAGTAA
TCCCCCCAGCGTGTGAAGATGGAACTGTAGTGTTTTCTATACGTAAGCCATCAGTTAGTAGATTTAGCTT
GACTGATTATGTTAACTCTAATAGGTTAAGTGGATTTCAAGATGTGGCTAATGCACAAAGAACTACGGAG
GGTATTCTTTTACATCAACATGAACAGCAATTATTGCAATATAAAGAGACACAGGATTTAGGTTCTTTTT
TTCGACTTGCTATTGAGAAAAAACTAAATATTTGTATGGTAGGCGGTACTGGTTCTGGTAAGACTACATT
TACAAAAGCATTAGCTGATTTAATTCCTCTTGATACAAGAATCATAACAATTGAAGATACACATGAGTTA
GATTTACCAAATCATGTAAATCACGTACACCTTTTTTATAAAGAAAACATTACTGCAAAATCGTTAATAG
CAACTTGTATGAGGTTAAAGCCAGATAGGATTTTACTTACTGAATTAAGAGGTGATGAAGCGTTTGATTA
TTTAAGTGCGTTAAATACGGGCCATGCAGGGGGATTAACTTCGGTACATGCAAATGACGCCGAAAGTGTT
TTTTACCGTATTACTCAATTAGCTAAAGAAAGCGTGGCAGGGCGGGCGATGGATTATAACTATTTACTTA
ATATAGTTAGGTCAACTATAGATGTTGTATGTTTTTTTGAAAAAACATACTTAACAGAGCTTTATTACGA
TCCGATAGCTAAACATACTGCCCTTAAAGGAAGATAA
 Primer design