SecReT4
Protein ID: 319778335
T4SS name [ID]VirB [209]
Gene symbol-
Locus tagTEQUI_0149
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T4SS(s) in this replicon]
Location [Strand]154054..156126 [+]
ProductType IV secretion system protein VirD4
Component typeVirD4
UniProt IDE8UDJ7
KEGG IDteq:TEQUI_0149
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8e-112, Aligned region: 118..555
TraG-D_C [PF12696], Evalue: 4.2e-30, Aligned region: 406..525
TrwB_AAD_bind [PF10412], Evalue: 1.3e-26, Aligned region: 319..539
Protein Sequence: 690 a.a.     [Download]
>gi|319778335|ref|YP_004129248.1| Type IV secretion system protein VirD4 [Taylorella equigenitalis MCE9]
MKEKKKGLVVVLIFWLVITLLGLAFGGFIFALLSGVKVFPNPVILFKYMEFWELFYYKIGVGIAFVFSLF
GLALGFIVVNKKPRRELHGSARFANSVEIKNFNLFDEKHKDPEILIGKFDNKFLKWSGKQFAFLAAPTRS
GKGVGIVIPNCLNYRDSMVVFDPKLENFQITGGFREKVLGQKVYLFNPSTKDFRSHCWNPMSYISRDKYR
MVGDALNMANILYSSTESEGGGGNSKFFAEMAQKLFTGLVLYMVERENLEKGTDNWDDSKVPSMSLLQSL
TTQYPSEYSSFANWIKKCVAVDKNYSQACKENLMSYATTSDQTGASILSSLVAPLSVFSDPIVQRVTSSD
DFDLREVRKQKMTIYIGIQPNDIAKFSRLINLFVSQLISLNTEELPEQNKSLKYQCLLLLDEFAALGKVD
IIEKSVAYIAGYNLRLLLIFQNMSQLNRIYTKDGARSLSTNFECQIIYPPRDNDDAKEYSEIIGYETYKS
ESKSKNKGQIGSSSTSISDQKRAVMNPEELRQMDKSDCIISMTGIYPIHAKKIIYYKDPFFKKRLGFEPS
PIPLIKEFKESDVNNSDKTDTGKSGGINIEHAKQQKEEKLEYVSLLELMNDSDIDVKEVVEEIKDTFIEM
LFPSLDEEEKEKIQKIIPRIQHACATSLKNTTVEEIISIKEEIKDSKNLSKRERKNDYDF
 
Nucleotide Sequence: 2073 bp     [Download]
>gi|319778189|ref|NC_014914.1|:154054-156126 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGAAAGAAAAGAAAAAAGGACTAGTCGTAGTCCTTATTTTTTGGCTTGTAATAACCCTTTTAGGGTTGG
CATTTGGTGGGTTTATATTTGCATTATTATCAGGAGTTAAGGTGTTTCCCAATCCCGTTATATTGTTTAA
ATATATGGAATTTTGGGAACTTTTTTACTATAAGATAGGTGTAGGAATTGCTTTTGTATTCTCACTATTT
GGGTTGGCTTTAGGGTTTATCGTAGTAAATAAAAAGCCCCGTAGAGAATTACATGGTTCTGCTAGATTTG
CAAATAGTGTAGAAATCAAAAACTTTAATCTTTTTGATGAAAAGCATAAAGACCCAGAAATACTTATAGG
AAAATTTGATAATAAATTTCTTAAGTGGTCTGGAAAACAATTTGCATTCTTAGCTGCGCCTACTCGTTCT
GGTAAGGGTGTTGGGATAGTAATTCCAAACTGCTTAAATTATCGTGATTCCATGGTAGTTTTTGACCCAA
AACTAGAAAACTTTCAAATAACAGGAGGTTTTAGAGAAAAGGTTTTAGGGCAAAAGGTTTATTTATTTAA
CCCTTCAACAAAAGATTTTAGAAGCCATTGTTGGAATCCGATGAGTTATATAAGTCGTGATAAATATCGC
ATGGTGGGAGACGCCTTGAATATGGCAAACATTCTATATTCAAGCACAGAAAGTGAAGGCGGTGGCGGTA
ATTCAAAGTTCTTTGCTGAAATGGCTCAAAAGCTATTTACAGGACTTGTGCTTTATATGGTAGAAAGAGA
GAATTTAGAAAAAGGCACTGATAATTGGGACGATTCAAAAGTACCTTCAATGTCATTGTTGCAAAGCTTA
ACAACACAGTATCCATCTGAATACTCATCGTTTGCTAATTGGATTAAAAAATGCGTAGCAGTTGATAAGA
ATTACTCACAAGCATGTAAGGAAAACTTGATGAGTTATGCAACAACATCAGATCAAACTGGTGCGTCTAT
ACTTTCATCACTAGTAGCCCCACTAAGTGTATTTAGTGATCCGATTGTTCAAAGAGTAACTAGTTCAGAT
GATTTTGACTTACGGGAAGTAAGAAAACAAAAAATGACTATATATATTGGTATTCAGCCAAATGATATAG
CTAAGTTTTCAAGACTTATTAATCTGTTTGTCTCACAATTAATATCATTGAATACAGAAGAATTGCCAGA
GCAAAATAAATCATTAAAGTATCAATGTTTATTGTTGCTTGATGAGTTCGCAGCTTTAGGTAAAGTGGAT
ATCATTGAAAAATCCGTCGCTTACATAGCAGGTTATAACTTAAGGCTTTTATTAATTTTCCAAAACATGA
GCCAGCTTAATAGGATATATACAAAAGATGGTGCAAGAAGTTTGTCTACAAACTTTGAGTGCCAAATAAT
ATATCCTCCTCGTGATAATGATGACGCTAAGGAATATTCTGAGATTATAGGGTATGAGACATATAAATCA
GAAAGTAAATCTAAAAACAAAGGACAGATTGGTAGTTCCTCAACAAGTATAAGCGATCAGAAACGTGCGG
TTATGAATCCAGAAGAGTTAAGACAGATGGATAAGAGCGATTGCATTATTTCAATGACGGGGATTTATCC
AATACATGCTAAGAAGATTATCTACTACAAAGACCCATTTTTTAAAAAGAGATTGGGTTTTGAGCCATCA
CCTATTCCGTTAATTAAAGAATTTAAAGAAAGTGATGTAAATAATAGTGATAAAACCGATACTGGTAAAT
CGGGTGGTATTAATATTGAGCATGCTAAGCAACAAAAGGAAGAAAAACTTGAATATGTAAGTTTATTAGA
ACTTATGAATGATAGTGATATTGATGTTAAGGAAGTAGTAGAGGAAATTAAAGATACCTTTATAGAAATG
CTTTTTCCATCACTTGATGAAGAAGAAAAGGAGAAAATTCAAAAAATCATACCAAGAATTCAGCACGCTT
GTGCAACGTCACTTAAAAATACGACTGTTGAAGAAATCATTTCCATAAAAGAGGAAATTAAAGATTCAAA
AAATTTAAGTAAACGTGAAAGAAAAAATGACTATGATTTTTGA
 Primer design