SecReT4
Protein ID: 319785186
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5515
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5703920..5704948 [-]
ProductATPase P
Component typeTrbG
UniProt IDE8TFE9
KEGG IDmci:Mesci_5515
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.1e-68, Aligned region: 105..324
Protein Sequence: 342 a.a.     [Download]
>gi|319785186|ref|YP_004144662.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MTNKAPSLRAALILSASAAVLSACASKPVPPPEIAYDAADFKAASIEKPPEKPVKIVEVPKPLPLPGQLQ
PDPVKFAEDKRSPEERVADANRAATRQPTRYGYVNAVQVYPFTDGALYQLFAAPERVTDIALQPGEKLTA
VSAGDTVRWVIGDTVSGTGDGQRTHVLVKPFAPELTTNLVITTDRRTYHLQLQSTDKTAMAAISWTYSED
QILALSRRNVQADAATPVASNVALENIRFRYSIAGDTPPWRPTRAFDDGSKVYIEFPRRIDQGEAPPLFI
VGADGGNQLVNYRMRGNYYIVDRLFAAAELRLGAKPQQVVRISRIDGGQLPRRMPLFAGFGR
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5704948-5703920 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGACAAATAAAGCCCCATCGCTCCGTGCCGCGCTGATCCTGTCGGCCTCGGCAGCGGTGCTATCCGCCT
GCGCATCCAAGCCGGTGCCGCCGCCCGAGATTGCCTATGACGCTGCCGACTTCAAAGCAGCGTCGATCGA
GAAGCCGCCAGAGAAACCGGTTAAAATCGTCGAGGTGCCAAAGCCGCTACCGCTTCCCGGCCAGTTGCAG
CCTGACCCGGTCAAGTTCGCCGAAGACAAGCGCTCTCCTGAAGAACGCGTTGCCGATGCCAATAGGGCCG
CAACTCGGCAGCCAACCAGGTATGGCTATGTCAACGCGGTCCAGGTCTATCCCTTCACCGATGGCGCGCT
TTATCAGCTCTTTGCCGCGCCGGAGCGCGTCACCGATATCGCTCTGCAGCCGGGCGAGAAACTGACGGCG
GTGTCCGCCGGGGACACGGTCCGCTGGGTCATCGGCGACACCGTCAGTGGCACCGGTGACGGTCAGCGCA
CCCATGTTTTGGTGAAGCCGTTCGCGCCCGAGCTTACCACAAATCTGGTGATCACCACGGATCGACGCAC
CTATCACTTGCAGCTCCAAAGCACGGACAAGACCGCAATGGCGGCCATCTCTTGGACTTACAGCGAAGAC
CAGATCCTTGCGCTCTCCCGGCGAAACGTTCAGGCCGACGCTGCAACGCCGGTCGCATCGAATGTTGCGC
TCGAAAATATCCGCTTCCGCTATTCAATCGCCGGCGACACTCCGCCCTGGAGGCCGACACGGGCCTTTGA
CGACGGCAGCAAAGTCTATATCGAATTCCCCCGGCGCATCGATCAGGGCGAGGCGCCACCGCTCTTCATC
GTCGGTGCCGACGGCGGCAATCAGCTGGTCAACTACCGCATGCGTGGCAACTACTACATCGTCGATCGCC
TGTTCGCCGCGGCCGAACTGCGCCTCGGGGCCAAGCCGCAGCAGGTCGTTCGCATCTCAAGGATTGACGG
CGGGCAATTGCCGCGTCGGATGCCACTCTTTGCCGGTTTCGGCAGGTGA
 Primer design