SecReT4
Protein ID: 319785188
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5517
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5705670..5706992 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDE8TFF1
KEGG IDmci:Mesci_5517
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-44, Aligned region: 37..262
Protein Sequence: 440 a.a.     [Download]
>gi|319785188|ref|YP_004144664.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MNDLGVIDRFMETFIRYIDSGFGLLSGDVAFLTTTLIGIDITLAGLAWAFAGEPNILGRFIRKVLYVGVF
AFILNNFKNLADIIYRSFAGLGISASAANLSSDSLLRPGRIAATGFEGAWPLLDQASQLLGFPEIFGNAL
TIFVLLVAWFLVIIAFFILSIQLFITILEFKLTTLAGFVLVPFAVWSRSAFLAERVLGNVISSGIKVMVL
AVIVGVGSTLFGEFASALQGKEPDLAAAMSQVLGALALLGLGIFGPGIASGLVSGAPQLGAGAALGTAAA
AAGASLIAGGAAIAGVRMAADGGLAAIRAGTTIGSAASSAWQLGRATSPDSGLSGVAAGMQGVAGAASGA
AVRAARSAAETVGRSADAGRQAAWTATGGSPIASMTETPSGPTTDAAPSWARRLRSQQSARAHRHATMQA
VRDGDRPGGSANPSLNDKDD
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5706992-5705670 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAACGACCTCGGGGTCATCGATCGCTTCATGGAGACTTTCATCCGCTATATTGACAGCGGGTTTGGTC
TGCTGTCGGGCGATGTCGCCTTCCTCACCACGACCCTGATCGGCATCGACATCACGTTAGCCGGGCTCGC
TTGGGCATTCGCCGGCGAGCCCAACATTCTCGGCCGCTTCATCCGCAAGGTGCTCTATGTCGGCGTCTTC
GCTTTCATCCTGAACAATTTCAAGAATCTCGCCGACATTATATACCGCTCCTTCGCAGGGCTGGGCATCA
GCGCTTCGGCCGCCAATCTGTCGTCCGACAGTCTCCTGCGGCCCGGACGTATTGCTGCCACAGGCTTCGA
GGGCGCGTGGCCGCTGCTGGATCAGGCGAGCCAGCTTCTTGGCTTTCCCGAAATCTTCGGCAACGCGCTC
ACCATTTTCGTGCTGCTCGTGGCCTGGTTCCTGGTCATCATTGCCTTCTTCATTCTTTCCATCCAGCTCT
TCATCACCATTCTGGAGTTCAAGCTCACCACTCTCGCCGGCTTCGTTCTGGTGCCCTTCGCAGTCTGGAG
CAGGTCGGCGTTCCTGGCCGAGCGCGTGCTCGGCAACGTGATCTCGTCGGGCATCAAGGTGATGGTGCTT
GCGGTCATTGTCGGTGTCGGGTCCACGCTGTTCGGCGAGTTCGCTTCGGCGCTGCAAGGCAAGGAGCCGG
ATTTGGCCGCCGCCATGTCACAGGTGTTGGGCGCGCTGGCGCTGCTTGGGCTAGGTATTTTCGGGCCTGG
AATAGCGTCCGGTCTCGTCTCGGGTGCCCCGCAGCTTGGTGCGGGCGCTGCACTGGGTACGGCCGCGGCC
GCCGCCGGTGCGTCACTCATTGCGGGAGGCGCTGCGATCGCTGGGGTGCGCATGGCAGCTGATGGCGGGC
TTGCCGCAATTCGCGCCGGCACCACGATCGGTTCGGCAGCTTCCTCTGCCTGGCAACTAGGACGCGCAAC
CTCGCCTGACTCCGGCCTGTCCGGTGTGGCTGCCGGGATGCAGGGCGTGGCAGGTGCTGCCAGCGGCGCC
GCTGTGCGAGCGGCACGATCTGCCGCGGAAACCGTCGGGCGCAGCGCTGATGCCGGGCGCCAGGCCGCAT
GGACCGCGACCGGCGGGTCTCCCATCGCCTCGATGACCGAAACTCCTTCGGGTCCGACCACCGATGCTGC
CCCTAGCTGGGCCAGGCGCCTGCGTTCCCAGCAGTCTGCGCGAGCCCACCGCCACGCCACCATGCAGGCC
GTGCGCGATGGTGACAGACCGGGCGGTAGCGCCAATCCCTCTCTCAACGACAAGGACGACTAG
 Primer design