SecReT4
Protein ID: 319785191
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5520
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5710187..5710459 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeTrbD
UniProt IDE8TFF4
KEGG IDmci:Mesci_5520
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.8e-12, Aligned region: 6..85
Protein Sequence: 90 a.a.     [Download]
>gi|319785191|ref|YP_004144667.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MFAREHHIEGFEVPVHRALTEPILLGGAPRAVAILSGTVAAAVGLGLQQWIAGLVLWTCAHTVAVFAARR
DPDFASVLVRHLRLKGWLAC
 
Nucleotide Sequence: 273 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5710459-5710187 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGTTCGCCAGAGAGCACCATATCGAGGGCTTTGAGGTTCCGGTTCACCGGGCACTGACCGAACCAATCT
TGCTCGGCGGCGCGCCGCGAGCGGTGGCCATCCTCAGTGGCACCGTCGCCGCGGCCGTCGGGCTGGGGTT
GCAGCAGTGGATTGCCGGATTGGTGCTGTGGACCTGCGCGCACACCGTGGCTGTCTTCGCGGCCCGCCGC
GACCCCGATTTCGCCAGCGTGCTCGTCCGCCATCTTCGCCTGAAGGGGTGGCTCGCATGCTGA
 Primer design