SecReT4
Protein ID: 319785192
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5521
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5710459..5710767 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDE8TFF5
KEGG IDmci:Mesci_5521
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.1e-26, Aligned region: 2..92
Protein Sequence: 102 a.a.     [Download]
>gi|319785192|ref|YP_004144668.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MRKKPRFLWATTLAFLLTFPAYAAGSGMPWEQPLQQILESVQGPVAKIIAVIIIISTGLTLAFGDTAGGF
RRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 309 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5710767-5710459 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGCGCAAGAAGCCTCGCTTTCTCTGGGCCACCACGCTCGCGTTTCTTCTCACGTTTCCGGCATACGCCG
CCGGCTCCGGAATGCCCTGGGAGCAGCCGCTGCAGCAGATCTTGGAATCAGTGCAGGGGCCGGTCGCCAA
GATCATCGCGGTCATCATCATCATCAGCACCGGCCTGACACTCGCCTTCGGGGACACGGCAGGTGGGTTC
CGTCGGCTCATCCAGATTGTCTTCGGCCTGTCGATCGCCTTTGCCGCATCGAGCTTCTTCCTCTCCTTCT
TCTCCTTTGGCGGCGGGGCACTCGTCTGA
 Primer design