SecReT4
Protein ID: 319785199
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5528
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5719231..5719914 [-]
Productlytic transglycosylase
Component typeTrbN
UniProt IDE8TFG2
KEGG IDmci:Mesci_5528
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 227 a.a.     [Download]
>gi|319785199|ref|YP_004144675.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MDRVALLMLGMIAVAPCACSASTGAEPVAISQSPQLRRWHEFTGEASKRFRVPEAWIYAVIDAESSGKTM
LHGRPITSRAGAMGLMQVMPETYQDMRAQYGLGADPHDPRDNILAGTAYLRAMYDRFGFPGLFAAYNAGP
ERYQAHLKRGTPLPKETVDYLKQLRAAGVSGTDIEQFKGKSVAPSRQDAPSGRSLFFPQNGDRAGARNGD
LFVPLGSDVAQVKEPER
 
Nucleotide Sequence: 684 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5719914-5719231 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGGACCGAGTAGCCCTCCTGATGCTTGGCATGATCGCTGTCGCGCCATGCGCCTGTTCCGCCTCGACCG
GCGCTGAGCCGGTCGCCATCTCCCAAAGTCCGCAACTTCGAAGGTGGCATGAGTTCACAGGCGAAGCAAG
CAAGCGTTTCCGTGTTCCCGAGGCCTGGATTTACGCGGTGATCGATGCCGAAAGCAGCGGCAAGACGATG
CTCCACGGCCGGCCGATCACCTCGCGCGCCGGTGCCATGGGCCTCATGCAGGTGATGCCGGAAACCTATC
AGGACATGCGTGCGCAATACGGACTGGGCGCCGATCCCCACGATCCGCGCGACAACATTCTGGCCGGCAC
TGCCTATCTTCGGGCCATGTATGACCGCTTCGGGTTCCCCGGTCTGTTTGCCGCTTACAACGCCGGACCC
GAGCGCTACCAGGCGCATCTGAAGCGCGGCACGCCGCTGCCGAAAGAGACCGTCGATTACCTCAAGCAGC
TCCGGGCGGCCGGAGTTTCGGGAACCGACATCGAGCAGTTCAAGGGCAAATCTGTCGCTCCAAGCAGGCA
AGATGCACCCTCGGGGCGCTCGCTGTTTTTCCCGCAAAATGGTGATCGCGCCGGCGCGCGAAACGGCGAT
CTCTTCGTGCCGCTGGGAAGCGACGTCGCACAGGTCAAGGAGCCGGAACGCTAG
 Primer design