SecReT4
Protein ID: 319785200
T4SS name [ID]Trb [297]
Gene symbol-
Locus tagMesci_5529
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5719902..5720450 [-]
Productpeptidase S26, conserved region
Component typeTraF
UniProt IDE8TFG3
KEGG IDmci:Mesci_5529
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 6.4e-48, Aligned region: 45..181
Protein Sequence: 182 a.a.     [Download]
>gi|319785200|ref|YP_004144676.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSRPPVIRLTGSRLRRVRATRAIAATAIALGLIAFGPLANPSPWLIWNASASAPVGLYRVMAGAPARGDL
VLAGAPDAIAGLAAERGYLPNGVPLVKHIAALPHERVCAFNEAIIIGGKIVARRLATDTQGRPLPWWSGC
RALADDEFFVLNGEAPRSFDSRYFGPVRAANIIGRLAPLWTE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5720450-5719902 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAGCCGGCCTCCTGTCATCCGTCTGACCGGCAGCCGCCTGCGCCGTGTCCGGGCGACAAGGGCGATCG
CCGCGACCGCGATTGCCCTTGGCCTGATTGCCTTCGGCCCGCTTGCAAACCCGTCGCCCTGGCTGATCTG
GAACGCCTCGGCGAGCGCGCCGGTCGGCCTCTATCGCGTCATGGCGGGAGCGCCAGCACGCGGCGACCTG
GTGCTCGCCGGCGCACCGGATGCCATTGCCGGCCTTGCTGCCGAACGCGGCTATCTCCCGAACGGCGTTC
CCCTTGTAAAGCACATTGCCGCGCTGCCGCACGAACGTGTCTGCGCCTTCAACGAGGCGATCATCATCGG
CGGCAAGATCGTCGCACGTCGGCTCGCAACCGACACCCAAGGCCGTCCGCTGCCATGGTGGAGCGGCTGC
CGCGCGCTCGCTGACGACGAATTCTTCGTGCTGAACGGCGAGGCACCGCGCTCTTTCGACAGCCGCTATT
TCGGGCCGGTCCGAGCCGCCAACATCATCGGGAGGCTCGCGCCGCTATGGACCGAGTAG
 Primer design