SecReT4
Protein ID: 319785258
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5590
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5773468..5774508 [-]
ProductATPase P
Component typeVirB11
UniProt IDE8TFM1
KEGG IDmci:Mesci_5590
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-57, Aligned region: 15..312
Mg_chelatase [PF01078], Evalue: 6.8e-05, Aligned region: 156..201
Protein Sequence: 346 a.a.     [Download]
>gi|319785258|ref|YP_004144734.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MQSEADPQLRLLLDPVLKWLEEPRTEEVAINRPGEAFVRQAGVFTKHPLPLSYDDLEDIAILAGALRKQD
VGPQSPLCATELPNGERLQICLPPAVPSGTISLTIRRPSSRVTELKEVSSRYEYSRWNQWRSRKERQERQ
DETILQHYDHGDLEQFLRACVCGRLTMLLCGPTGSGKTTMSKTLINAIPPHERLISIEDTLELAIPHENH
VRLLYPKDRAGAGAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHAGSISTIHGADPVQGFK
KLFSLVKSSAQGAAVEDRTLLDMLSAAIDVIIPFRTQGDVYEVGEVWLAADARRRGETVADLLNKH
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5774508-5773468 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGCAATCGGAGGCTGATCCTCAATTGCGTTTGCTTCTCGATCCCGTTCTGAAATGGCTTGAGGAGCCAA
GAACCGAAGAGGTCGCTATCAACCGGCCTGGGGAAGCCTTTGTCCGACAGGCCGGCGTTTTCACGAAACA
TCCACTGCCGCTGTCTTATGACGATCTGGAGGACATCGCGATCCTCGCCGGAGCGCTGCGCAAGCAAGAT
GTCGGACCGCAAAGCCCCCTCTGCGCGACTGAGTTGCCGAACGGAGAGCGGCTGCAGATCTGTTTGCCCC
CCGCAGTACCCTCAGGAACAATAAGCCTGACGATACGGCGTCCCTCAAGTCGTGTGACCGAACTCAAGGA
AGTTTCTTCTCGCTACGAGTATTCGCGTTGGAATCAATGGCGGTCACGAAAAGAGCGCCAAGAGCGGCAG
GACGAAACGATTCTTCAGCACTACGACCATGGTGACTTGGAGCAATTTTTGCGAGCCTGCGTCTGCGGGC
GGCTCACAATGCTGCTTTGCGGACCTACTGGAAGCGGCAAAACGACAATGAGCAAGACTTTGATCAACGC
TATACCCCCGCATGAGAGGTTGATCAGCATCGAGGACACGCTCGAACTTGCAATCCCGCACGAGAACCAT
GTCCGCTTACTCTATCCAAAGGACCGAGCAGGCGCAGGGGCGGTGACGGCCGAGCAACTGTTGCAAGCCA
GCTTGCGCATGCGCCCTGATCGAATATTGCTTGGCGAGATGCGCGATGACGCCGCTTGGGCCTACCTTAG
TGAAGTCGTCTCCGGCCATGCGGGATCGATATCAACGATTCATGGGGCTGATCCGGTACAAGGTTTCAAG
AAGCTCTTTTCACTCGTCAAGAGCAGCGCGCAAGGAGCCGCTGTCGAAGACCGCACGCTTCTTGACATGC
TGTCGGCCGCCATTGACGTCATCATACCGTTCCGTACCCAAGGCGACGTGTATGAGGTAGGAGAGGTATG
GCTCGCCGCCGATGCCCGGCGACGGGGAGAGACAGTAGCCGACCTTCTCAACAAGCACTAA
 Primer design