SecReT4
Protein ID: 319785259
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5591
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5774492..5775634 [-]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDE8TFM2
KEGG IDmci:Mesci_5591
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.4e-58, Aligned region: 175..351
Protein Sequence: 380 a.a.     [Download]
>gi|319785259|ref|YP_004144735.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MNETGPQAGHDVHASGSMVSEPARRHVSGSQKLAVAALVLISSLSLIWLGGRSSTQDEPSQPKPPIDANV
EPFRPVPIEVAPEPPAPAEAAKAAEPAPSTPPLPAADDPPPEESPIFAYSGSGQMPNDDQRSEDKQNDAP
ATADEISNGGDLSGRLKPDIQEPSRATLLPHPDLVITQGTIIPCILQTAVDTNLPGYVKCVLPKAVRGAT
NNVVLLDRGTTVIGEIQRGLQQGDARVFVLWTRIETPDHALVSIASPGADELGRSGMPGTVDNHFRERFG
GAILMSVIQGAFQAAGQYAASSGGGSGTNSFQSNGGQAVETTLRATINLPPTLKKNQGDAVSIFVARDLD
FSDVYDLRATAAAPSPQHRERRRNNNAIGG
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5775634-5774492 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAATGAAACCGGTCCACAGGCGGGACATGATGTCCATGCATCCGGATCGATGGTCTCGGAGCCGGCCC
GCCGGCATGTTTCGGGATCGCAGAAGTTGGCCGTCGCTGCTCTTGTTCTCATCTCGTCTCTATCGCTCAT
CTGGCTCGGAGGTCGTTCCAGCACACAAGACGAACCATCTCAGCCAAAACCGCCAATTGACGCCAACGTC
GAGCCATTCCGTCCCGTGCCAATCGAGGTTGCTCCCGAACCTCCAGCACCCGCAGAGGCGGCCAAGGCGG
CAGAGCCTGCGCCATCCACGCCGCCCCTACCAGCGGCAGATGATCCGCCGCCGGAGGAATCACCAATTTT
CGCCTACAGCGGCAGCGGTCAAATGCCCAATGACGATCAGCGGAGCGAAGACAAGCAAAATGATGCTCCG
GCGACCGCAGATGAGATTTCAAACGGTGGCGATCTGTCAGGCCGATTGAAGCCAGATATACAGGAGCCGA
GCCGGGCCACACTTTTGCCGCACCCTGATCTCGTGATTACTCAAGGAACGATCATTCCCTGCATTTTGCA
AACTGCGGTCGACACAAATTTACCCGGCTATGTGAAGTGCGTCTTACCTAAAGCCGTCCGAGGCGCCACC
AACAACGTCGTGCTCTTGGATCGCGGGACAACCGTGATTGGCGAGATCCAGCGCGGTCTCCAGCAGGGGG
ATGCGCGTGTATTCGTGCTGTGGACGCGCATCGAAACACCCGACCATGCCCTCGTTTCGATAGCATCGCC
GGGGGCTGACGAGCTCGGCCGCTCCGGAATGCCTGGCACGGTGGACAATCACTTCCGGGAACGCTTTGGC
GGAGCGATTCTGATGAGCGTCATCCAAGGCGCGTTTCAGGCGGCTGGTCAATATGCGGCCAGCTCTGGCG
GAGGAAGCGGCACCAACAGCTTCCAGAGCAATGGTGGACAAGCCGTCGAGACGACATTGAGAGCGACGAT
CAACCTTCCCCCAACCCTGAAGAAAAACCAAGGAGACGCCGTATCCATCTTTGTGGCTCGGGACCTCGAC
TTCTCGGATGTATACGATCTTAGAGCGACTGCCGCAGCGCCATCCCCCCAACATCGCGAACGCCGGAGAA
ACAACAATGCAATCGGAGGCTGA
 Primer design