SecReT4
Protein ID: 319785260
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5592
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5775631..5776512 [-]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDE8TGH3
KEGG IDmci:Mesci_5592
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8.4e-48, Aligned region: 31..266
Protein Sequence: 293 a.a.     [Download]
>gi|319785260|ref|YP_004144736.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MTKRAFLALACSLFLTMEACAEDTPLAGKHDARMRYLAYRPDEVVRLSTAVGATLVVTFAANETVAAVAV
SNSKDLAALPRANYLFFKASRMLSPQPVVVLAESESGTRRYVFSISTKAMPKLDEKQPDLYYSVQFTYPA
DEAAARRKEAERRSILGQARARVLQDERVRDLLNRPAAAASPDDSNFHYVAKGDRSLAPLEVFDNGFTTV
FGFASNSRIPSLYVINPDGKEAAANYTVKGDYVEVSAVAREWRLRDGNTVLSIFNRAYDPVGRAPATGTV
TPDVWRVLKGSGR
 
Nucleotide Sequence: 882 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5776512-5775631 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGACAAAAAGAGCATTTCTGGCGCTGGCCTGTTCACTCTTCCTGACGATGGAAGCGTGCGCCGAAGACA
CGCCACTTGCCGGCAAGCATGATGCTCGGATGCGCTACCTGGCTTACCGCCCCGACGAAGTGGTGCGCCT
ATCGACCGCAGTTGGGGCAACGCTGGTTGTCACATTCGCGGCCAACGAGACCGTCGCAGCCGTGGCCGTT
TCCAATAGCAAAGACCTGGCTGCGCTCCCGCGCGCCAATTATCTCTTTTTCAAGGCTAGCCGGATGCTGT
CGCCGCAGCCGGTCGTCGTGCTGGCCGAGAGCGAGTCCGGTACCCGCAGATACGTCTTCAGCATTTCAAC
GAAAGCGATGCCAAAACTCGATGAGAAGCAACCAGATCTATACTACAGTGTGCAGTTCACCTATCCTGCT
GATGAGGCTGCTGCTCGGAGAAAGGAAGCAGAAAGGCGCTCAATTCTTGGCCAGGCCCGGGCGAGAGTGC
TGCAAGACGAAAGAGTTCGGGATTTGTTGAATCGGCCCGCCGCAGCTGCCAGTCCGGACGACAGCAATTT
TCACTACGTCGCAAAGGGCGATCGGTCGCTCGCGCCGTTGGAAGTCTTCGATAATGGCTTTACGACCGTA
TTTGGATTCGCAAGCAATTCCCGCATACCCTCCCTCTACGTTATCAATCCCGACGGCAAGGAAGCCGCTG
CCAATTACACGGTCAAAGGCGACTATGTTGAAGTATCCGCCGTCGCCCGGGAATGGCGTCTGAGAGATGG
CAACACGGTCTTGTCCATTTTCAACAGAGCTTATGACCCTGTGGGACGAGCGCCAGCGACCGGTACAGTG
ACACCCGACGTGTGGCGTGTTTTGAAAGGCTCGGGACGATGA
 Primer design