SecReT4
Protein ID: 319785261
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5593
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5776509..5777222 [-]
Producttype IV secretory pathway component VirB8 protein
Component typeVirB8
UniProt IDE8TGH4
KEGG IDmci:Mesci_5593
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-44, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|319785261|ref|YP_004144737.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MKFPEHALLVERETLAAHYKKVEAFQTSRAKSARRLSKALIAFAAAAVLGNVAQAFTIAAMVPLAKLVPV
FLWVRPDGTVDSEVSISRLPATQDRAVINASLWEYVRLREGYTADTAQYAYDLVSSFSAPSVQQQYQDFF
NYPNPTSPQVTVGKRGKLEVGHISSNDISPDVQQIRYKRTLVIDGQTPIVTSWTATIRYERLTGLPGQSR
LTNPGGLLVTSYQASQDTVSNLGFVQP
 
Nucleotide Sequence: 714 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5777222-5776509 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
GTGAAATTTCCTGAACATGCCCTTCTGGTGGAGAGAGAAACGCTAGCCGCTCACTATAAGAAGGTGGAAG
CGTTTCAAACTTCTCGAGCGAAGTCTGCGCGGCGCTTGTCAAAGGCGCTTATAGCCTTTGCCGCAGCGGC
GGTCCTGGGAAATGTCGCCCAGGCATTTACCATCGCTGCCATGGTCCCGTTGGCCAAGCTCGTACCTGTG
TTCCTCTGGGTGCGGCCGGACGGTACCGTTGACAGCGAAGTGTCAATCTCTCGACTGCCGGCAACCCAAG
ACCGAGCCGTCATAAACGCTTCGCTATGGGAATATGTACGCCTTCGCGAGGGCTACACGGCAGATACAGC
CCAATACGCCTATGACCTCGTCTCCAGTTTCAGCGCACCTTCTGTGCAACAGCAATATCAAGATTTCTTC
AACTATCCCAACCCCACCTCGCCGCAGGTCACGGTTGGGAAGCGCGGCAAGCTCGAGGTCGGGCATATTT
CATCAAATGACATCAGTCCCGACGTTCAGCAGATCCGATACAAACGTACGCTTGTTATCGATGGGCAGAC
GCCGATAGTGACCTCCTGGACTGCTACCATCCGCTACGAGCGCTTGACGGGTCTGCCTGGGCAATCGAGG
CTCACCAATCCGGGAGGTCTACTCGTCACATCCTATCAAGCCTCGCAAGACACCGTATCGAACCTGGGCT
TCGTGCAGCCATGA
 Primer design