SecReT4
Protein ID: 319785262
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5594
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5777219..5777377 [-]
Producttype IV secretion system lipoprotein VirB7
Component typeVirB7
UniProt IDE8TGH5
KEGG IDmci:Mesci_5594
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 52 a.a.     [Download]
>gi|319785262|ref|YP_004144738.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MKRYLLLLILALAACKTTDRLATCTGTPFQLNAGQWETTPEDLQVECAEEPK
 
Nucleotide Sequence: 159 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5777377-5777219 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAAACGCTATCTACTGTTGCTAATCCTCGCTTTGGCGGCCTGCAAGACAACCGATCGGCTTGCGACCT
GCACGGGTACGCCATTCCAACTGAACGCGGGACAATGGGAAACCACTCCTGAGGATCTTCAGGTCGAGTG
CGCGGAAGAGCCCAAGTGA
 Primer design