SecReT4
Protein ID: 319785263
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5595
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5777400..5778287 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDE8TGH6
KEGG IDmci:Mesci_5595
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-31, Aligned region: 43..270
Protein Sequence: 295 a.a.     [Download]
>gi|319785263|ref|YP_004144739.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MNFKIAAPFTAIHTIFDLAFTSGLHNVLEKIQEAVSAPLVACVTLWIIIQGCLVMRGQVDARGSISRVIM
VSIVVALILDQSNYQQYIEAFFDDTIPRFAHKISSSDLPFVDIPRKLDFMFAASQYAFQMIASEIGTMNG
QDILAFQGAQWIFYGSLWTAFEIYDAVGILTKLLLAIGPLVLVGYLFDRTRDMATRWIGQLLSYGLLLLL
LNIVATIVIAAEAVSLTAMLIIIKMSGTTAAKIIGLYELDMLFLAGDALIIALPTIASSIAGGSLAGENR
PLSNLNRYFAKTAGG
 
Nucleotide Sequence: 888 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5778287-5777400 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAATTTCAAGATTGCCGCGCCATTCACGGCCATACACACGATCTTTGATCTGGCCTTTACCTCAGGGC
TGCACAACGTGCTTGAAAAGATCCAAGAGGCGGTCAGCGCACCTCTGGTTGCGTGTGTAACGCTTTGGAT
AATAATACAAGGCTGTCTGGTCATGCGTGGTCAAGTCGATGCGCGCGGGAGTATCTCGCGCGTAATCATG
GTGTCGATTGTCGTTGCCCTGATCTTGGACCAGTCTAACTACCAGCAGTACATTGAAGCGTTCTTCGACG
ACACGATTCCAAGATTTGCTCACAAGATAAGTAGCAGCGACTTGCCATTCGTCGATATTCCTCGGAAGCT
AGACTTTATGTTTGCTGCAAGCCAGTATGCTTTTCAGATGATTGCTTCCGAAATTGGGACAATGAATGGC
CAGGACATACTTGCCTTCCAGGGAGCGCAATGGATTTTCTACGGCTCGCTGTGGACGGCGTTCGAGATCT
ACGATGCCGTTGGAATTCTGACGAAGCTGCTCTTGGCGATCGGCCCCCTGGTCCTTGTCGGCTACCTTTT
TGATCGCACGCGAGACATGGCCACCAGATGGATCGGCCAACTGCTCTCGTACGGGCTGCTGCTTCTCCTT
CTCAACATCGTTGCGACGATAGTTATTGCGGCCGAAGCAGTCTCGCTGACAGCAATGCTTATCATAATCA
AAATGTCGGGCACGACAGCAGCCAAGATCATCGGGCTTTACGAGCTCGATATGCTCTTCCTCGCTGGCGA
CGCTCTGATCATCGCGCTTCCGACGATCGCCAGCAGCATCGCCGGCGGCTCTTTGGCAGGCGAGAACCGA
CCTCTTAGCAACCTCAACCGCTACTTTGCCAAAACGGCGGGTGGTTAA
 Primer design