SecReT4
Protein ID: 319785264
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5596
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5778346..5779029 [-]
Producttype IV secretion system protein VirB5
Component typeVirB5
UniProt IDE8TGH7
KEGG IDmci:Mesci_5596
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 227 a.a.     [Download]
>gi|319785264|ref|YP_004144740.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MRFAKLVVTTFAVSFLLSTQARSQLIVTDPAVTVQAGLTAGSTAAMLIKSAQTLATTIEMVEILKSSFAV
TGLLGALNQGNHYPSSNKLEGQMFDARAPVSTMARTIVQDPTRRVTGTDSEAKLLEGQITGAANAAALAA
DTLDTMDKRLKANDNTPGQLSRSRNIVQATVTNGLVLKQIHDAVIQNVEATSLLTMTTAQGSLHAVEEAA
TQRRERQDTAKMFGTLP
 
Nucleotide Sequence: 684 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5779029-5778346 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAGATTTGCCAAACTTGTAGTGACGACGTTTGCTGTTTCCTTTCTGCTTAGCACACAGGCCAGGTCGC
AATTAATCGTCACCGACCCGGCAGTGACAGTACAAGCGGGCCTAACAGCGGGTTCCACAGCGGCGATGCT
TATAAAGTCAGCTCAGACGCTCGCTACCACGATCGAAATGGTAGAGATACTGAAGTCGTCATTTGCTGTC
ACGGGTCTGCTGGGCGCACTGAACCAGGGAAACCACTACCCATCGAGCAATAAGCTGGAGGGGCAGATGT
TTGATGCTCGGGCGCCGGTTTCGACCATGGCGCGTACCATTGTGCAAGACCCAACCCGGAGAGTCACCGG
CACCGATTCAGAAGCGAAACTGTTAGAGGGGCAAATCACTGGTGCCGCCAATGCGGCAGCTCTTGCAGCC
GACACTCTGGACACAATGGACAAGCGCCTTAAGGCTAACGACAACACGCCTGGTCAGCTTTCGCGCTCGC
GAAATATTGTGCAGGCCACCGTGACCAACGGTCTGGTCCTCAAGCAGATTCACGATGCGGTCATCCAAAA
TGTCGAGGCCACGAGTCTGCTGACGATGACCACTGCACAAGGCAGCCTTCACGCCGTGGAGGAGGCCGCC
ACGCAGCGTCGCGAGCGCCAGGACACCGCCAAGATGTTTGGCACACTGCCGTGA
 Primer design