SecReT4
Protein ID: 319785265
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5597
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5779042..5781411 [-]
Producttype IV secretion/conjugal transfer ATPase
Component typeVirB4
UniProt IDE8TGH8
KEGG IDmci:Mesci_5597
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2e-60, Aligned region: 172..375
AAA_10 [PF12846], Evalue: 3.9e-24, Aligned region: 429..701
Protein Sequence: 789 a.a.     [Download]
>gi|319785265|ref|YP_004144741.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MFGASGRTERSGEIYLPYVGHLSDQVVLLEDGSIMAMAHLNGLPFDLEDAEMRNSRCRAFNTLLRNIADD
NVTLYAHLVRNNDVPEPASRQFQSAFAGSLSEAYESRVLSGKLFRNDHFLTVVVFPRTAIGKIGWRSAKS
SRGNDNDLATQMRSLEDLWQIIAGSLGGYGLRRLGIREKGDVLFTEIGEALRLIMTCRFLPVPMVSGSLG
ASIYTDQVICGKRALEIRRPGGSSVGSLFSFREYPATTRPGMLNPLLSANFPLVLSQSFSFLTRPQAHAK
LSLKSSQMTSAGDKALTQINELAEAEDALASNQFVMGSHHLSLCVYAESLNSLADRAANARGRLADAGAV
IVQEGIGMEAAYWSQLPGNNRWRTRPGAITSHNFAGLVSFENFPNGSASGHWGKAVARFRTNGGTSFDYI
PHENDVGMTAIFGPVGKGKTTLMTFILAMLEQSVVDRDGAIVFFDKDRGGELLVRATGGTYLALRRGAPS
GLAPLRGLDNTSASLDFLREWLMALIESDGRGPISPEESRRLERGIVRQLSFEPVMRSIAGLREFLLHGP
SEGAGARLQRWCRGNALGWAFDGDVDEVRLDASITGFDMTQLLEYEEVCAPAAAYLLHRVGAVVDGRRFV
MSCDEFRFYLLNPQFSAVIDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRA
AYVDGLKCTTQEFEAIRHGMAIGSRKFLLKRDSGSVVCEFDLGQMREYVAVLSGRANTVRFADQLRDQHG
DAPSGWLDEFMARYHEVQD
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5781411-5779042 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGTTTGGCGCCAGTGGCAGGACCGAGAGATCTGGCGAGATCTACCTTCCGTATGTCGGTCATCTGAGCG
ACCAGGTTGTCCTTCTGGAAGATGGATCGATTATGGCCATGGCACATCTGAACGGGCTGCCATTTGATTT
GGAAGACGCTGAGATGCGCAACTCGCGCTGCCGCGCGTTCAACACTCTCTTGCGCAACATCGCCGACGAC
AATGTCACGCTGTACGCCCATCTTGTGCGAAACAACGATGTGCCGGAGCCGGCATCGCGCCAGTTTCAAA
GTGCATTCGCTGGCAGTCTGAGCGAGGCGTATGAGAGCCGTGTGCTGTCGGGCAAGCTATTTCGCAACGA
CCATTTCCTCACTGTCGTCGTGTTCCCCCGCACCGCAATCGGCAAGATCGGCTGGCGTAGCGCCAAATCG
TCCAGAGGCAATGACAACGATCTGGCCACACAAATGCGAAGCTTGGAGGACCTCTGGCAGATCATTGCTG
GCTCACTGGGCGGTTACGGTCTGCGCCGGTTGGGCATTCGTGAGAAAGGCGACGTGCTCTTCACGGAAAT
CGGTGAGGCGCTTCGGTTGATAATGACGTGCCGGTTTCTTCCGGTTCCGATGGTTAGCGGCTCACTCGGC
GCCTCGATCTACACTGACCAGGTCATCTGCGGGAAGCGGGCGCTTGAGATTCGACGGCCCGGGGGCAGCT
CGGTGGGGTCATTGTTTTCGTTCCGTGAATATCCGGCGACGACGCGGCCCGGCATGCTAAATCCCTTGCT
GTCGGCCAACTTCCCGCTTGTGCTCAGCCAGAGCTTTTCCTTCCTCACTCGGCCCCAAGCTCATGCGAAG
CTTAGCCTTAAGTCCAGCCAGATGACGAGCGCCGGCGACAAGGCTCTCACCCAGATCAATGAACTTGCCG
AAGCAGAGGACGCACTGGCAAGCAACCAGTTCGTCATGGGTTCGCATCATCTGAGCCTGTGCGTCTATGC
CGAGAGCCTCAACAGCCTTGCAGATCGCGCAGCAAATGCCCGCGGAAGGCTGGCCGATGCGGGCGCCGTT
ATCGTCCAAGAGGGTATCGGTATGGAGGCCGCGTACTGGTCCCAACTTCCGGGGAACAACAGGTGGCGCA
CACGCCCCGGGGCGATCACCTCGCACAATTTTGCCGGGCTCGTGTCATTTGAGAACTTCCCAAACGGTTC
CGCATCCGGCCACTGGGGCAAAGCTGTTGCGCGCTTTCGCACGAACGGTGGAACTTCTTTCGACTACATC
CCCCATGAGAATGACGTTGGCATGACGGCGATATTCGGGCCCGTCGGCAAAGGCAAGACGACGCTGATGA
CCTTTATCCTCGCGATGCTTGAGCAAAGCGTGGTCGATCGCGATGGTGCCATCGTCTTTTTCGATAAGGA
CCGGGGTGGTGAACTGCTGGTGCGGGCCACGGGGGGGACATATCTAGCCTTGCGCAGAGGCGCTCCGAGC
GGCTTGGCCCCTCTGCGTGGACTGGACAACACCTCCGCCTCGTTGGACTTTCTGCGCGAATGGTTGATGG
CCCTTATCGAGAGTGACGGCCGCGGTCCGATCTCGCCGGAGGAAAGCCGCCGACTAGAACGTGGCATTGT
TCGTCAACTTTCGTTCGAACCCGTGATGCGCTCAATTGCGGGCCTGCGCGAATTCCTGCTGCACGGCCCC
TCCGAGGGCGCAGGAGCACGGCTGCAGCGGTGGTGTAGAGGGAATGCGCTTGGATGGGCCTTTGACGGCG
ATGTCGACGAAGTAAGGCTTGATGCCTCCATCACCGGCTTCGACATGACGCAGCTCCTGGAATATGAGGA
GGTCTGTGCGCCGGCCGCCGCATATCTTCTGCACCGCGTGGGCGCCGTTGTCGATGGCCGTCGGTTCGTC
ATGAGCTGCGACGAATTTCGCTTCTATCTGCTCAACCCGCAGTTCTCGGCTGTTATCGACAAGTTCTTGC
TCACCGTCCGCAAGAACAACGGGATGTTGATACTTGCAACGCAGCAGCCCGAACACGTGCTGGAATCGCC
GCTGGGAGCCAGTCTCGTTGCACAATGCATGACGAAGATTTTCTACCCGTCACCGACTGCGGACCGGGCC
GCGTATGTCGATGGCTTGAAGTGCACCACGCAGGAGTTCGAGGCGATCCGCCACGGAATGGCAATTGGCA
GCCGCAAGTTTTTGCTCAAGCGCGACAGCGGGAGTGTTGTTTGCGAATTCGACCTTGGCCAGATGCGCGA
GTACGTAGCCGTACTCTCGGGGCGGGCCAACACCGTGCGCTTTGCCGACCAGCTTCGTGACCAGCACGGA
GATGCCCCAAGCGGGTGGCTCGACGAGTTCATGGCTCGTTACCACGAAGTTCAAGACTGA
 Primer design