SecReT4
Protein ID: 319785266
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5598
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5781411..5781737 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDE8TGH9
KEGG IDmci:Mesci_5598
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.3e-20, Aligned region: 1..89
Protein Sequence: 108 a.a.     [Download]
>gi|319785266|ref|YP_004144742.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MSDRLEVSTLYVAATRPALFLGVPLTLAGALMMLAGLVIIILKNPLYEVVLVPLWFGARLIVERDYNAAS
VAFLYLQTAGRSVDGSVWGGASVSANPIRVPKRGRGMV
 
Nucleotide Sequence: 327 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5781737-5781411 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGAGCGACCGGCTGGAAGTGAGCACCCTCTATGTGGCGGCGACACGCCCCGCACTGTTTTTGGGGGTGC
CGCTGACGCTGGCCGGAGCGCTCATGATGTTGGCGGGACTCGTCATCATCATCCTTAAGAACCCGCTCTA
TGAAGTCGTGCTCGTGCCACTCTGGTTCGGAGCACGGCTGATTGTTGAGCGCGACTATAACGCCGCAAGC
GTGGCGTTTCTCTATTTGCAGACCGCCGGCAGAAGCGTGGATGGGTCGGTCTGGGGCGGGGCGAGCGTCA
GCGCCAATCCGATCAGAGTGCCGAAGCGCGGAAGAGGAATGGTGTGA
 Primer design