SecReT4
Protein ID: 319785267
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5599
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5781737..5782102 [-]
Productconjugal transfer protein Trbc
Component typeVirB2
UniProt IDE8TGI0
KEGG IDmci:Mesci_5599
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-19, Aligned region: 24..116
Protein Sequence: 121 a.a.     [Download]
>gi|319785267|ref|YP_004144743.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MIKPLKILRALKTRVPSPFSMLRMAAEYAPAAAAGVAWTVFSSGPAAAQVTGGTDPAKMVQNICTFILGP
FGQSLAVLGLVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKALIGAG
 
Nucleotide Sequence: 366 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5782102-5781737 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGATCAAGCCACTCAAAATACTTCGTGCGCTTAAAACGCGTGTTCCTTCGCCTTTTTCCATGCTGCGAA
TGGCGGCTGAATACGCGCCGGCCGCTGCTGCGGGCGTGGCGTGGACGGTCTTCTCCAGCGGGCCGGCCGC
GGCACAGGTGACCGGAGGGACGGATCCCGCCAAGATGGTCCAGAATATCTGCACCTTCATACTTGGTCCC
TTCGGACAATCACTGGCCGTGCTCGGACTCGTGGCCATCGGGATCTCCTGGATGTTCGGTCGTGCTTCAC
TTGGCCTGGTTGCGGGTGTCGTTGGAGGAATCGTCATCATGTTTGGCGCCAGCTTCCTGGGCAAGGCGCT
GATAGGCGCTGGCTGA
 Primer design