SecReT4
Protein ID: 319785268
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5600
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5782117..5782890 [-]
Productlytic transglycosylase
Component typeVirB1
UniProt IDE8TGI1
KEGG IDmci:Mesci_5600
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.3e-26, Aligned region: 33..170
Protein Sequence: 257 a.a.     [Download]
>gi|319785268|ref|YP_004144744.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MFIAVWPLAIVLLTSMSLPAEPAPLSPREFHRLSRKCAPWVAPSTLAAIAKIESGFETLVAHDNTTGEQL
RWIDHLQATRGIKDRLEAQHSVDVGLMQINSNNFPTLNLTPEKAFEPCASLSAAAHLLESRYAGGATAPA
QQLALRRAISAYNTGDVTRGFANGYVRKVELAAKDMSETTQEPTAQDAPHLEAPGRKAVPPLLQLNQKAN
QKQPRQNSWAIWGSYQTNRSGADPSGPTDSQAADEREPSNPNKLVFD
 
Nucleotide Sequence: 774 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5782890-5782117 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGTTTATTGCAGTTTGGCCGCTGGCCATCGTTCTGTTGACATCCATGTCACTCCCAGCCGAGCCCGCCC
CACTTTCGCCCCGTGAGTTCCACCGCCTGTCACGCAAATGCGCTCCCTGGGTCGCGCCGTCCACCCTTGC
CGCGATTGCCAAGATTGAAAGTGGCTTTGAAACGCTGGTGGCTCATGACAACACCACAGGTGAGCAGCTT
CGCTGGATAGACCACCTGCAAGCCACGCGGGGCATCAAGGACCGACTCGAAGCACAACATTCCGTCGATG
TTGGATTGATGCAGATAAACAGCAACAACTTTCCCACGCTCAATCTCACGCCGGAAAAGGCTTTCGAGCC
CTGCGCCTCGCTTTCGGCCGCCGCCCACTTGCTTGAAAGCCGGTATGCCGGCGGCGCGACTGCCCCGGCG
CAGCAACTGGCGCTTCGCCGTGCCATCTCGGCCTATAACACGGGTGACGTCACGCGTGGCTTTGCCAACG
GTTATGTACGCAAGGTCGAGTTGGCCGCAAAGGACATGTCAGAGACAACGCAGGAGCCGACCGCCCAAGA
TGCGCCACACCTTGAGGCACCGGGTCGGAAAGCAGTGCCGCCTCTGCTCCAACTGAACCAAAAGGCCAAC
CAAAAGCAGCCCCGCCAAAATTCCTGGGCCATCTGGGGCTCCTATCAGACAAACCGCTCCGGGGCCGATC
CCTCCGGTCCGACAGACAGCCAGGCTGCCGATGAGCGGGAACCCTCGAATCCGAACAAACTCGTATTCGA
TTGA
 Primer design