SecReT4
Protein ID: 319785273
T4SS name [ID]VirB [13]
Gene symbol-
Locus tagMesci_5606
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconchromosome [GenBank: NC_014923] [Browse all T4SS(s) in this replicon]
Location [Strand]5790775..5792520 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDE8TGI6
KEGG IDmci:Mesci_5606
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-146, Aligned region: 97..538
TraG-D_C [PF12696], Evalue: 2.9e-29, Aligned region: 391..509
TrwB_AAD_bind [PF10412], Evalue: 2.9e-26, Aligned region: 137..519
AAA_10 [PF12846], Evalue: 5.1e-07, Aligned region: 140..467
Protein Sequence: 581 a.a.     [Download]
>gi|319785273|ref|YP_004144749.1| unnamed protein product [Mesorhizobium ciceri biovar biserrulae WSM1271]
MPSTKTTTPNLAVSIACSLAVGFCAASLYATFRHGGGGEALMAFDVRAFWFETPFYLGFATPVFYRGAAI
VLSTSVVVLLIQQVVLRRKLEHHGTARWARVDEMRRTGYLRRYRGVKGPVFGKTSGPFWPGYYLTNGEQP
HSLIVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARKAAGDDVFKFAPLDSERRTNCYNPL
LDLIALPPQLQFTEARRLAANLITAKGEGAEGFISGARDIFVAGILACIERGTPTIGAVYDLFAQPGEKF
KLFAQLAMETRNKEAQRIFDDMAGNDTKILTSYTSVLGDGGLNLWADPAVKAATSRSDFSVYDLRRRRTC
IYLCVGPNDLEVIAPLIRLFFQQIVSILQRSLPRPEEKHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR
FMLIIQSLSALTGAYGEAGKQNFLSNTGLQVFMATADDETPNYISKAIGEYTFEAKSISYSQARRFDWNI
QNSHQGAPLLRPEQVRLLDDDYEIVLIKGLPPLQLRKVRYFSDRILKRIFEGQTGALPEPAPLTEAEEEL
STDFRLDEPPRGLAQEFNDTV
 
Nucleotide Sequence: 1746 bp     [Download]
>gi|319779749|ref|NC_014923.1|:c5792520-5790775 Mesorhizobium ciceri biovar biserrulae WSM1271 chromosome, complete genome
ATGCCTTCAACCAAAACGACGACCCCCAACCTAGCCGTTAGCATCGCCTGCTCGCTCGCCGTGGGCTTCT
GTGCGGCAAGTCTGTACGCAACCTTCCGCCACGGCGGTGGCGGCGAGGCCTTGATGGCGTTTGATGTCCG
TGCCTTTTGGTTTGAGACGCCCTTCTATCTGGGTTTCGCAACCCCCGTCTTCTATCGGGGCGCGGCTATC
GTGCTCTCGACATCCGTGGTCGTCTTGCTGATTCAGCAGGTCGTGTTGCGCCGCAAGCTCGAACACCACG
GGACGGCTCGTTGGGCTCGAGTGGATGAAATGCGACGCACCGGATATCTGCGACGATACCGTGGCGTGAA
AGGACCGGTATTTGGGAAGACGAGTGGCCCTTTCTGGCCTGGCTACTACCTGACCAATGGCGAGCAGCCT
CACAGCCTCATCGTTGCACCGACCCGCGCTGGCAAGGGCGTCGGCGTAGTCATTCCAACGCTACTTACAT
TCAAAGGCTCAGTGATAGCTCTGGACGTCAAGGGGGAGCTCTTTGAGCTCACCTCGAGGGCGCGCAAAGC
CGCAGGCGATGACGTGTTCAAATTCGCGCCGCTGGATTCGGAGCGGCGCACGAACTGCTACAATCCACTG
TTGGACCTTATAGCGCTGCCTCCACAGCTCCAATTCACGGAAGCCCGCCGCTTGGCCGCAAACCTGATTA
CGGCCAAGGGGGAAGGCGCGGAAGGTTTCATCAGCGGCGCGCGAGATATCTTTGTCGCGGGGATCCTTGC
CTGCATCGAGCGGGGTACGCCGACAATCGGCGCCGTCTATGATCTCTTCGCCCAGCCGGGGGAGAAGTTT
AAGCTCTTCGCGCAACTCGCGATGGAGACCCGGAACAAAGAGGCTCAACGCATCTTCGACGACATGGCGG
GGAACGACACAAAAATACTGACCTCCTACACGTCAGTGCTCGGCGATGGCGGGCTCAATCTCTGGGCGGA
TCCCGCTGTTAAGGCGGCCACAAGTCGCTCGGACTTTTCGGTGTATGATCTTCGCCGTCGCAGAACGTGC
ATCTATCTTTGCGTTGGTCCGAACGACCTTGAGGTGATCGCGCCTTTGATACGCTTGTTTTTTCAGCAGA
TCGTTTCAATTCTACAGCGGTCGCTGCCCCGCCCGGAGGAAAAGCACGAGGTTCTCTTCCTGCTCGATGA
GTTCAAGCACTTGGGTAAGCTGGAGGCGATCGAGACCGCAATTACGACTATCGCGGGCTACAAGGGGCGT
TTCATGCTCATCATCCAAAGCCTTTCGGCACTGACAGGGGCTTATGGAGAGGCTGGCAAGCAGAATTTTC
TCAGCAATACCGGCCTGCAAGTGTTCATGGCAACGGCCGATGACGAGACCCCAAATTACATTTCCAAAGC
CATCGGTGAATACACGTTTGAAGCCAAATCGATTTCCTACAGCCAGGCGCGAAGATTCGATTGGAACATT
CAGAATTCGCATCAAGGTGCACCGCTGTTGCGTCCCGAACAGGTTCGGCTGCTCGACGACGACTACGAGA
TCGTTCTCATCAAAGGTCTGCCACCATTGCAATTGAGGAAGGTGCGATATTTTTCGGACCGCATTCTGAA
ACGCATCTTTGAAGGCCAGACAGGCGCCCTCCCGGAGCCGGCACCGTTGACGGAAGCAGAGGAGGAACTC
TCCACAGACTTTCGACTCGATGAGCCGCCGCGTGGATTGGCGCAGGAATTTAACGATACCGTTTGA
 Primer design