SecReT4
Protein ID: 31983482
T4SS name [ID]VirB [202]
Gene symbol-
Locus tagpF3031_p18
StrainHaemophilus influenzae biotype aegyptius plasmid pF3031 (NC_004846)
Repliconplasmid pF3031 [GenBank: NC_004846] [Browse all T4SS(s) in this replicon]
Location [Strand]15126..15281 [+]
ProductTraN/VirB7-like protein
Component typeVirB7
UniProt IDQ8VRD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 51 a.a.     [Download]
>gi|31983482|ref|NP_858098.1| TraN/VirB7-like protein [Haemophilus influenzae biotype aegyptius]
MKTLFLIITTSLLLSACSSPPQPNEPKGKWYQINSSHYYEENANKTITTKP
 
Nucleotide Sequence: 156 bp     [Download]
>gi|31983465|ref|NC_004846.1|:15126-15281 Haemophilus influenzae biotype aegyptius plasmid pF3031, complete sequence
ATGAAAACTCTATTTTTAATTATAACCACATCATTGTTACTTTCGGCTTGTAGCTCACCGCCGCAACCGA
ATGAGCCTAAAGGAAAGTGGTATCAAATCAACAGCTCTCACTACTACGAAGAGAACGCTAACAAAACAAT
CACAACAAAGCCGTAA
 Primer design