SecReT4
Protein ID: 31983483
T4SS name [ID]VirB [202]
Gene symbol-
Locus tagpF3031_p19
StrainHaemophilus influenzae biotype aegyptius plasmid pF3031 (NC_004846)
Repliconplasmid pF3031 [GenBank: NC_004846] [Browse all T4SS(s) in this replicon]
Location [Strand]15295..16068 [+]
ProductTraE/VirB8-like protein
Component typeVirB8
UniProt IDQ8VRD1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-59, Aligned region: 42..251
Protein Sequence: 257 a.a.     [Download]
>gi|31983483|ref|NP_858099.1| TraE/VirB8-like protein [Haemophilus influenzae biotype aegyptius]
MKIFNRSKPKLLNENVEALAEEPTPAERKIVNERAKEHFKRKQEFEKDRVGFYKTLSKVGFGVGGIGALI
GLAGVIAVAGLTPLKTSEPYVIRVDNNTGFTDIVKPISDSSQTTYGEELDKYWLSKFIIERESYDWQLVQ
NSYDAVELMTTPQVFNEYKAYITSKVSPVNLLQQNKKIKVRVLSVSFINGIGQVRFSKQVLTASGDPDSV
IPTTYWLASIPFDYKHDIKLEQQRLINPLGFQALSYRADPESNLSEK
 
Nucleotide Sequence: 774 bp     [Download]
>gi|31983465|ref|NC_004846.1|:15295-16068 Haemophilus influenzae biotype aegyptius plasmid pF3031, complete sequence
ATGAAAATTTTTAACCGTTCTAAACCAAAATTATTAAATGAGAACGTGGAAGCGTTGGCTGAAGAGCCAA
CGCCAGCCGAAAGAAAAATCGTAAATGAAAGAGCCAAAGAACACTTTAAACGTAAACAAGAGTTTGAGAA
AGATCGTGTTGGTTTTTACAAAACACTTTCAAAAGTTGGTTTTGGTGTCGGTGGCATAGGGGCATTAATT
GGTCTTGCAGGCGTAATTGCCGTTGCAGGTCTTACTCCATTAAAAACATCGGAGCCGTATGTAATCCGTG
TCGATAACAATACAGGCTTTACCGATATTGTTAAACCTATTTCTGATAGTTCCCAAACCACATACGGCGA
GGAGTTAGACAAATATTGGCTCTCGAAGTTCATTATTGAACGAGAATCTTATGATTGGCAGCTCGTGCAA
AATTCGTATGACGCAGTAGAGCTGATGACAACGCCTCAAGTATTTAACGAATATAAGGCTTACATCACAA
GTAAAGTATCTCCAGTAAATTTATTACAACAAAACAAGAAAATTAAAGTGCGTGTACTTTCTGTTTCATT
TATTAACGGTATCGGTCAAGTCAGATTCTCAAAACAAGTTTTGACGGCAAGCGGTGATCCTGATTCCGTT
ATCCCTACGACTTATTGGCTTGCTTCAATTCCTTTTGACTATAAGCACGACATCAAGCTTGAGCAGCAAC
GTTTAATCAATCCATTAGGATTTCAGGCTTTAAGCTATCGTGCTGACCCTGAAAGTAATTTGAGTGAGAA
ATAG
 Primer design