SecReT4
Protein ID: 31983486
T4SS name [ID]VirB [202]
Gene symbol-
Locus tagpF3031_p22
StrainHaemophilus influenzae biotype aegyptius plasmid pF3031 (NC_004846)
Repliconplasmid pF3031 [GenBank: NC_004846] [Browse all T4SS(s) in this replicon]
Location [Strand]18037..19095 [+]
ProductTraG/VirB11-like protein
Component typeVirB11
UniProt IDQ8VRC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-52, Aligned region: 26..329
Protein Sequence: 352 a.a.     [Download]
>gi|31983486|ref|NP_858102.1| TraG/VirB11-like protein [Haemophilus influenzae biotype aegyptius]
MNLENEELEAGHIDNSAVARAMLKKTGIQAILDREDITEVAVNQGNRIFFEGKNGWEYVEAPECNYHNLK
ALANALSVFSGLKLPFGDQNPIISVVLPDGERGQILTHPATESGTIPITLRKPSKTRFTVDDYQNSGRFS
KIQIAEAYQKGTIPLYMQQMKKCQKEGNYAEFFRIAAAHNMNTIAVGGTGSGKTTFAKAYADLVPFDHRT
ITIEDVHELSLPYHWNHLHLFFDTEYQKSGGISPKELIKSAMRMKPDHIFLTELRGDETWNYFEALNTGH
NGSITSTHANDCRATIPRLTGLVMQSEIGKVLGEQYIQKTLSSALDVICYFKHTYMTEILFEPEKKLEAM
YE
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|31983465|ref|NC_004846.1|:18037-19095 Haemophilus influenzae biotype aegyptius plasmid pF3031, complete sequence
ATGAATCTTGAAAATGAAGAATTAGAAGCAGGGCATATTGATAATTCAGCCGTTGCAAGAGCAATGCTTA
AAAAAACAGGTATTCAAGCGATCTTAGATCGTGAAGATATTACTGAAGTCGCCGTAAATCAAGGAAATCG
TATTTTCTTTGAGGGCAAGAATGGCTGGGAATATGTAGAAGCTCCTGAATGTAACTATCACAACCTCAAG
GCGTTAGCTAACGCCTTGAGCGTGTTCAGCGGCTTAAAACTCCCATTTGGCGATCAAAACCCGATTATTT
CAGTTGTACTTCCTGACGGAGAACGTGGGCAGATTCTAACCCACCCAGCAACCGAATCAGGCACAATTCC
GATCACTTTGCGTAAACCCTCAAAAACTCGTTTTACTGTTGATGATTACCAAAATTCAGGGCGTTTTAGC
AAAATTCAGATTGCCGAAGCCTATCAAAAAGGCACGATTCCGCTTTATATGCAGCAAATGAAGAAATGCC
AAAAAGAGGGCAATTATGCTGAATTTTTTAGAATCGCCGCAGCTCACAATATGAATACGATTGCCGTAGG
CGGCACAGGCTCAGGTAAAACTACGTTTGCAAAAGCCTATGCAGACTTAGTACCGTTCGATCATCGCACT
ATTACAATCGAAGACGTTCACGAATTAAGTCTACCGTATCATTGGAATCATCTACACCTATTTTTTGATA
CTGAATATCAAAAATCAGGAGGGATTAGCCCAAAAGAACTTATTAAGTCAGCAATGCGTATGAAGCCTGA
TCATATTTTCTTAACAGAGTTACGGGGCGATGAAACTTGGAATTATTTTGAGGCATTAAACACAGGACAC
AATGGCAGTATTACCTCTACGCACGCTAATGATTGTAGAGCAACAATTCCTCGTTTAACAGGGCTTGTAA
TGCAATCTGAAATCGGCAAAGTGTTAGGTGAGCAATATATTCAAAAAACATTGAGTAGTGCTTTAGACGT
GATTTGTTACTTCAAGCATACCTATATGACTGAAATCTTATTCGAGCCTGAAAAGAAACTCGAAGCAATG
TATGAATAA
 Primer design