SecReT4
Protein ID: 319893402
T4SS name [ID]Tra_Tn [647]
Gene symbol-
Locus tagSPSINT_2113
StrainStaphylococcus pseudintermedius HKU10-03
Repliconchromosome [GenBank: NC_014925] [Browse all T4SS(s) in this replicon]
Location [Strand]2201927..2202859 [-]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDE8SFU3
KEGG IDssd:SPSINT_2113
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.3e-62, Aligned region: 83..310
Protein Sequence: 310 a.a.     [Download]
>gi|319893402|ref|YP_004150277.1| hypothetical protein SPSINT_2113 [Staphylococcus pseudintermedius HKU10-03]
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTIHETTI
IEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTVRKDIPVSSSVRGFQI
WTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGNMVLVKNPTITNIPKKSSYKPKAIES
EGTVDSITTNEINEFLTTFFKLYPTATASELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTV
EYIDQQTKATQVSQFDLVLEKNGSNWKIVK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|319891290|ref|NC_014925.1|:c2202859-2201927 Staphylococcus pseudintermedius HKU10-03 chromosome, complete genome
ATGAGAAAGGAAGATTTAATGATGAAATTTAGAAAAAATCAGAATAAAGAAAAACAGATACCAAAGGAAA
AGAAACCTCGTGTCTATAAGGTCAATCCTCATAAAAAGGTTGTGATTGCCTTGTGGGTACTTTTAGGGCT
TAGTTTCAGCTTTGCGATATTCAAGCACTTTACAGCTATAGATACTCATACTATTCACGAAACAACTATC
ATAGAAAAGGAATACGTTGATACTCATCATGTAGAAAATTTTGTAGAGAACTTTGCGAAAGTCTACTATT
CATGGGAGCAATCCGATAAGTCCATTGATAATCGAATGGAAAGTCTAAAAGGCTATCTGACAGATGAACT
TCAAGCTCTCAATGTTGATACAGTACGCAAAGATATTCCTGTATCGTCTTCTGTAAGAGGATTTCAGATA
TGGACGGTAGAGCCAACTGGCGACAATGAGTTTAATGTAACCTACAGTGTAGACCAGCTCATTACAGAGG
GAGAAAATACAAAGACCGTCCACTCTGCTTATATAGTGAGTGTCTATGTAGATGGTTCTGGAAATATGGT
ACTGGTTAAGAATCCGACCATTACCAACATACCTAAGAAATCAAGTTATAAACCAAAAGCCATTGAAAGT
GAGGGGACGGTTGATTCCATTACAACCAATGAAATCAATGAGTTTTTAACGACGTTCTTCAAGCTCTATC
CTACAGCGACAGCCAGTGAACTTTCCTACTATGTGAATGACGGGATATTAAAACCAATCGGAAAAGAGTA
CATCTTTCAAGAACTGGTAAATCCTATTCACAATCGTAAGGATAATCAAGTCACGGTATCGCTGACAGTG
GAGTATATCGACCAGCAGACCAAAGCAACGCAGGTATCTCAATTTGATTTGGTACTTGAAAAGAACGGGA
GTAATTGGAAGATTGTAAAATAA
 Primer design