SecReT4
Protein ID: 319893405
T4SS name [ID]Tra_Tn [647]
Gene symbol-
Locus tagSPSINT_2116
StrainStaphylococcus pseudintermedius HKU10-03
Repliconchromosome [GenBank: NC_014925] [Browse all T4SS(s) in this replicon]
Location [Strand]2206034..2208481 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDE8SFU6
KEGG IDssd:SPSINT_2116
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-33, Aligned region: 468..763
Protein Sequence: 815 a.a.     [Download]
>gi|319893405|ref|YP_004150280.1| hypothetical protein SPSINT_2116 [Staphylococcus pseudintermedius HKU10-03]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYH
LSKKKLDNETLIKYYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYK
LSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVL
YGAQAVIVDPKAERGRWKETLPEISHEINIVTLTSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGIS
SRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSIS
LEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|319891290|ref|NC_014925.1|:c2208481-2206034 Staphylococcus pseudintermedius HKU10-03 chromosome, complete genome
ATGGCATATCCAATTAAATACATTGAAAACAATCTCGTCTGGAATAAAGACGGGGAATGTTATGCTTACT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAAATTCATGCTTTACAAATCAGTACAGAATCCAGCATACGT
TCTGCACAAGAGCGTTCCAAAAATGAAGTCACTGGCAAGCTCAAAGCGGTTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGAACTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCTATGAAAAGTCTTACCGTTGAAGCAAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGCTGATGGGCGATTTTGTTAGTATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTAGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGGTTAGATAAGGA
CGACTTCGGCTATCTGATTGAACACCTTTACGGACAGACAGGCACTGCCTATGAAGAGTATGAGTACCAT
CTATCAAAGAAAAAGCTGGATAATGAAACGCTGATTAAATACTATGACTTGATTAAGCCTACTCGCTGTT
TGGTGGAAGAAAAACAGCGATATTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTAGCTTACTTTAC
CATTAACAGCATTGTCGGAGAACTGGACTTCCCGTCCTCTGAAATCTTCTACTACCAGCAACAGCAATTT
ACATTCCCGATTGATACGTCAATGAATGTGGAAATTGTAGCGAATCGTAAAGCCCTATCTACTGTCCGCA
ATAAAAAGAAAGAACTGAAAGACTTGGATAACCACGCTTGGCAAAGTGATAATGAAACCAGCTCCAATGT
GGCGGAAGCTCTGGAAAGTGTGAATGAGCTGGAAACCAATTTAGACCAAAGCAAGGAATCTATGTACAAG
CTGTCTTATGTGGTAAGGGTATCAGCAAATGATCTTGACGAACTCAAACGTCGTTGTAATGAAGTGAAAG
ATTTTTATGACGATTTAAGCGTAAAACTGGTACGACCATTTGGGGATATGCTCGGCTTACATGAAGAATT
TTTACCTGCCAGCAAGCGTTATATGAATGATTATATTCAATACGTGACCTCTGATTTCCTCGCTGGTTTA
GGTTTTGGTGCTACTCAAATGCTGGGGGAAAATGAGGGGATTTATGTTGGCTACAGCTTAGATACTGGAC
GCAATGTCTATCTGAAACCTGCTCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTC
GGCTTTTGTTGGTTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCGGTGCTT
TATGGGGCACAAGCAGTGATTGTAGACCCAAAAGCAGAACGTGGCAGATGGAAAGAAACCTTGCCAGAGA
TTTCCCATGAAATCAATATCGTCACTCTGACTTCTGATGAGAAAAACAAAGGCTTACTTGACCCTTATGT
GATTATGAAAAATCCCAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACGGGGATTTCC
TCTCGTGATGGGGAACGCTTCCCAATCCTTAGAAAAGCCATTCGTGCAGTAACCAATAGTGAAGTACGAG
GGTTGATGAAAGTGATTGAGGAATTACGGGTTGAGAATACGCCACTAAGTACCAGTATAGCCGACCATAT
CGAAAGTTTTACAGACTATGACTTTGCACATTTATTATTCAGTAATGGTTATGTGGAGCAGTCTATCAGC
TTAGAAAAACAACTGAACATTATACAGGTTGCGGACTTGGTACTTCCCGACAAGGAAACTTCCTTTGAGG
AATATACCACTATGGAGCTTTTATCCGTTGCTATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCATACAGACCGAAGCATTTTCAAGATTGTAGATTTAGACGAAGCATGGAGCTTTTTACAGGTAGCACAA
GGAAAAACACTATCTATGAAGCTGGTTCGGGCTGGTCGTGCTATGAACGCTGGGGTATATTTCGTGACCC
AAAATACAGACGACCTCTTAGATGAAAAACTGAAAAATAACCTCGGCTTAAAATTTGCATTTCGTTCCAC
TGACCTTAACGAGATTAAAAAGACCTTAGCCTTTTTTGGTGTAGACCCAGAGGACGAAAACAATCAGAAG
CGATTGCGTGATTTGGAAAACGGGCAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGT
TCCACCCTGTATTTGAAGAACTGCTCCATGCCTTTGATACCAGACCACCTGTGCGAAAAGAGGTGTAA
 Primer design