SecReT4
Protein ID: 319898789
T4SS name [ID]VirB [230]
Gene symbolvirB2
Locus tagBARCL_0619
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]679426..679776 [+]
Producttype IV secretion system protein VirB2
Component typeVirB2
UniProt IDE6YFX3
KEGG IDbcd:BARCL_0080, bcd:BARCL_0619, bcd:BARCL_0650
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.2e-23, Aligned region: 16..111
Protein Sequence: 116 a.a.     [Download]
>gi|319898789|ref|YP_004158882.1| type IV secretion system protein VirB2 [Bartonella clarridgeiae 73]
MTNNISNNISKNIYISKNIYFIIITLFLTMLVMLNPAYAESSGAASGLGNIDSVLQAIVTMITGTTAKLI
ATICVAIVGIGWMYGVIDLRKAAYCVLGIGIVFGASALVTLLKGTP
 
Nucleotide Sequence: 351 bp     [Download]
>gi|319898193|ref|NC_014932.1|:679426-679776 Bartonella clarridgeiae 73, complete genome
ATGACAAACAACATATCTAACAATATATCTAAGAATATCTATATATCTAAGAATATCTATTTTATTATCA
TTACACTGTTTTTAACAATGCTTGTCATGTTAAACCCTGCTTATGCTGAGAGTAGCGGTGCTGCTAGTGG
TTTGGGGAATATTGATTCTGTTTTGCAGGCTATTGTTACTATGATAACAGGTACAACAGCGAAGCTCATT
GCAACTATATGTGTTGCTATTGTGGGTATTGGCTGGATGTATGGTGTTATTGATTTACGTAAAGCAGCAT
ACTGTGTTCTTGGTATTGGCATTGTTTTTGGTGCTTCTGCCCTTGTTACTTTATTAAAGGGGACACCATA
A
 Primer design