SecReT4
Protein ID: 319898790
T4SS name [ID]VirB [230]
Gene symbolvirB3
Locus tagBARCL_0620
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]679777..680085 [+]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDE6YFX2
KEGG IDbcd:BARCL_0079, bcd:BARCL_0620, bcd:BARCL_0649
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.1e-18, Aligned region: 3..85
Protein Sequence: 102 a.a.     [Download]
>gi|319898790|ref|YP_004158883.1| type IV secretion system protein VirB3 [Bartonella clarridgeiae 73]
MNEDTLFLACTRPAMFAGVTVEAMALNVMATSTLFIITSSFSMIGLGIGLHFILREITKRDHNQFRVLFA
WLNTRGKQKNLTRWGGGSTSPLRLIRTYKELN
 
Nucleotide Sequence: 309 bp     [Download]
>gi|319898193|ref|NC_014932.1|:679777-680085 Bartonella clarridgeiae 73, complete genome
ATGAACGAAGATACCCTTTTTCTTGCCTGTACAAGACCAGCTATGTTTGCAGGTGTTACCGTGGAAGCAA
TGGCATTGAATGTGATGGCAACATCTACTCTTTTTATCATTACAAGCAGTTTTTCAATGATTGGTCTTGG
TATTGGTTTGCACTTTATCTTACGGGAAATCACGAAACGGGATCATAACCAGTTTCGTGTTTTATTTGCT
TGGCTCAATACTCGAGGCAAACAAAAGAACCTGACAAGATGGGGTGGAGGATCTACATCTCCTCTACGCC
TCATCCGAACTTATAAGGAACTAAACTAA
 Primer design