SecReT4
Protein ID: 319898792
T4SS name [ID]VirB [230]
Gene symbolvirB5
Locus tagBARCL_0622
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]682410..682880 [+]
Producttype IV secretion system protein VirB5 ; 17-kDa antigen
Component typeVirB5
UniProt IDE6YFX0
KEGG IDbcd:BARCL_0077, bcd:BARCL_0622, bcd:BARCL_0647
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 156 a.a.     [Download]
>gi|319898792|ref|YP_004158885.1| type IV secretion system protein VirB5 ; 17-kDa antigen [Bartonella clarridgeiae 73]
MAAYISSKETNAMKKIMTMLFSSLCFISHAVSQDVEQYYQEAINPPSNTSPSKIAETIYASAITNEQKIK
EINDKILTADKEAKKSLQIELAILQSKLQVDALKLQAFSIIKSENNKSKEAEREEEQQKQHASIQKTLQE
QLEQAKSKVNIEPRSR
 
Nucleotide Sequence: 471 bp     [Download]
>gi|319898193|ref|NC_014932.1|:682410-682880 Bartonella clarridgeiae 73, complete genome
ATGGCTGCCTATATTTCATCAAAGGAGACGAACGCAATGAAAAAAATTATGACTATGCTCTTCTCATCTT
TATGTTTCATCTCTCACGCAGTATCACAAGATGTAGAGCAATATTATCAAGAGGCCATAAATCCACCATC
AAATACATCACCATCAAAAATAGCTGAAACTATTTATGCTTCAGCCATTACAAACGAACAAAAAATTAAA
GAAATCAATGATAAAATCTTAACAGCTGATAAAGAGGCAAAGAAGTCGCTTCAGATCGAGCTGGCTATTC
TTCAATCTAAACTTCAAGTAGATGCTCTAAAACTTCAGGCTTTTTCTATTATTAAATCGGAAAATAATAA
ATCAAAAGAAGCAGAGCGTGAAGAAGAACAACAAAAACAACATGCATCTATTCAAAAAACATTACAAGAA
CAGTTGGAGCAAGCTAAAAGTAAGGTCAACATTGAACCAAGATCAAGATAA
 Primer design