SecReT4
Protein ID: 319898794
T4SS name [ID]VirB [230]
Gene symbolvirB7
Locus tagBARCL_0624
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]684068..684394 [+]
Producttype IV secretion system protein VirB7, 15 kDa Antigen
Component typeVirB7
UniProt IDE6YFW8
KEGG IDbcd:BARCL_0075, bcd:BARCL_0624, bcd:BARCL_0645
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 108 a.a.     [Download]
>gi|319898794|ref|YP_004158887.1| type IV secretion system protein VirB7, 15 kDa Antigen [Bartonella clarridgeiae 73]
MKLKITIILILVIALIGCASLKSGPQKLPRCNGQNVRVLNQGKWNKWSWDDQNVLQHNTAVKPVPRAIIL
NTLENEIPKAHVELNTPPVDSIKHQAPSYKNAEITDEK
 
Nucleotide Sequence: 327 bp     [Download]
>gi|319898193|ref|NC_014932.1|:684068-684394 Bartonella clarridgeiae 73, complete genome
ATGAAACTAAAAATAACTATCATTTTGATCCTTGTGATAGCCCTTATCGGCTGTGCCTCTTTAAAGAGTG
GCCCTCAAAAACTCCCACGCTGTAATGGCCAGAATGTCCGTGTGCTCAATCAAGGTAAATGGAATAAATG
GAGCTGGGATGACCAAAACGTCCTCCAACACAATACAGCTGTTAAGCCAGTTCCACGTGCCATTATCCTT
AACACATTAGAAAATGAAATACCAAAAGCTCATGTCGAATTAAATACACCCCCTGTAGATTCAATAAAGC
ATCAAGCGCCATCTTATAAAAATGCGGAGATCACAGATGAAAAGTGA
 Primer design