SecReT4
Protein ID: 319898795
T4SS name [ID]VirB [230]
Gene symbolvirB8
Locus tagBARCL_0625
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]684369..685052 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDE6YFW7
KEGG IDbcd:BARCL_0074, bcd:BARCL_0625, bcd:BARCL_0644
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.3e-59, Aligned region: 17..224
Protein Sequence: 227 a.a.     [Download]
>gi|319898795|ref|YP_004158888.1| type IV secretion system protein VirB8 [Bartonella clarridgeiae 73]
MRRSQMKSDEFNEYIREARSFDIDRMRNMRLQMKIFMALTVLFGLMAIALALAVVALTPLKTVEPFVIRV
DNSTGIVDVVSVLKDEPQNYDEAITRYFVSKYIRARESFQLSETANNFRIISLLSSLEEQNRFAKWYSGN
NPESPQNIYQNMTVAITIKSISFLSKDLIQVRYYKTIRDPNGKEDISHWVSVMNFSYVNARLSVEDRLIN
PLGFQVSAYRSDPEVVQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|319898193|ref|NC_014932.1|:684369-685052 Bartonella clarridgeiae 73, complete genome
ATGCGGAGATCACAGATGAAAAGTGATGAATTTAACGAATATATAAGAGAAGCGCGGTCATTCGATATCG
ATCGTATGCGTAATATGCGACTGCAAATGAAAATTTTCATGGCTTTGACCGTGCTTTTTGGGTTGATGGC
AATCGCTTTAGCTTTAGCTGTAGTGGCATTAACACCCTTAAAAACCGTAGAACCTTTCGTTATCCGCGTG
GATAATTCTACCGGTATCGTCGATGTCGTCAGTGTTCTAAAAGATGAACCCCAAAATTATGATGAAGCAA
TAACACGCTATTTCGTTAGCAAATATATTCGTGCACGCGAAAGTTTCCAATTATCAGAAACAGCAAATAA
CTTTCGTATCATTTCTCTTTTATCCTCACTAGAAGAACAAAATCGTTTTGCCAAATGGTATTCGGGAAAT
AATCCAGAAAGCCCGCAAAATATCTATCAAAATATGACTGTAGCAATCACAATAAAATCCATCTCTTTTT
TAAGTAAAGATCTCATTCAAGTGCGGTACTATAAAACGATTAGAGATCCCAATGGAAAAGAAGATATTTC
CCATTGGGTTTCAGTTATGAATTTTTCCTACGTTAATGCACGCCTTTCAGTAGAAGATCGTTTAATTAAC
CCGCTTGGCTTCCAAGTATCGGCATATAGATCTGATCCAGAGGTGGTCCAATGA
 Primer design