SecReT4
Protein ID: 319898802
T4SS name [ID]VirB [230]
Gene symbolvirD4
Locus tagBARCL_0633
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]695214..697130 [+]
Producttype IV secretion system-coupling protein VirD4
Component typeVirD4
UniProt IDE6YHH6
KEGG IDbcd:BARCL_0633
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.1e-102, Aligned region: 159..634
TraG-D_C [PF12696], Evalue: 6e-29, Aligned region: 477..594
TrwB_AAD_bind [PF10412], Evalue: 7.3e-21, Aligned region: 319..610
Protein Sequence: 638 a.a.     [Download]
>gi|319898802|ref|YP_004158895.1| type IV secretion system-coupling protein VirD4 [Bartonella clarridgeiae 73]
MKYTKTQLVFILMPILLGALTIFFFPYLLLFMINGLQDYEKYWYIRSEPLLVLMFVVAIPLIYTISQKLY
LRKAITIVTAIFFTGTSLYYISCEVKRLSPYIGQQGITWSYAIKFIDNMIFFGIIGGVFLLAVQFLIATP
RKSKKGVKRAKKAIFGDASWMNLNEAKKIFPADGQIVIGERYRVDQDSVCNIPFAPGDKSTWGKGGTAPL
LTFNLDFGSTHMIFFAGSGGYKTTSTVIPACLKYPGSIVCLDPSTEVAPMVQLTRKKMNNRNVIVLDPTS
ISTKTFNVLDWLLDDSVPRTQREANIVGFSKLLLTDKKSENSSAEYFSTQAHNLLTALLAHVIFSDEYED
SERHLKTLRKILSQSETAVVNQLRNIQDTSPSPFIREMVGIFTEMADQTFSGVYTTAAKDTQWLSLSNYA
DLVCGDDFSSSDIADGNTDIFLNLPASILNSYPGIGRVIIGAFLNAMVTADGNYKKRVLFVLDEVDLLGY
MNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGKSGAQSWFESCSFVSYAAIKDLQTAKDISERCGQMTI
EVTGASKSRGQLLKGSKNMNYQQRSLILPHEIIQEMRQDEQIILMQGQPPLRCGRAIYFRRKELLAATEK
NRFAPKGK
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|319898193|ref|NC_014932.1|:695214-697130 Bartonella clarridgeiae 73, complete genome
ATGAAATATACAAAAACGCAGCTGGTTTTTATTTTAATGCCAATACTTTTGGGCGCTTTAACGATATTCT
TTTTTCCTTACTTATTATTATTTATGATAAATGGGTTACAGGATTATGAGAAATATTGGTATATTCGTTC
AGAACCATTATTGGTGCTGATGTTCGTTGTCGCCATACCATTAATTTATACTATATCGCAAAAATTATAT
TTACGCAAAGCGATTACAATTGTTACAGCGATTTTTTTTACTGGCACTTCTCTTTATTATATTAGCTGTG
AAGTTAAACGCTTAAGTCCTTATATCGGCCAACAAGGAATAACGTGGAGCTATGCTATAAAGTTTATCGA
TAACATGATTTTCTTTGGCATAATTGGCGGTGTTTTTCTTTTAGCAGTTCAATTCTTAATAGCAACTCCG
CGTAAAAGTAAAAAAGGAGTGAAGCGTGCCAAAAAAGCAATTTTTGGTGATGCATCATGGATGAATTTAA
ATGAAGCAAAAAAAATTTTTCCTGCAGATGGTCAAATTGTTATTGGCGAAAGATACCGTGTTGACCAAGA
TAGTGTGTGTAATATTCCCTTTGCGCCAGGTGATAAATCAACATGGGGGAAAGGTGGAACAGCGCCTTTG
TTAACATTTAATCTTGATTTTGGTTCAACACATATGATTTTTTTTGCTGGTTCTGGTGGCTATAAAACAA
CAAGTACAGTGATCCCAGCATGTTTAAAATATCCAGGATCCATTGTTTGTCTTGATCCTTCAACAGAAGT
TGCACCAATGGTTCAACTTACGCGTAAAAAAATGAATAATAGAAATGTTATTGTTCTTGATCCAACTTCA
ATATCAACAAAAACTTTCAATGTTCTCGATTGGCTTTTAGACGATAGCGTACCCCGCACACAACGTGAAG
CCAATATCGTAGGTTTTTCTAAATTGCTACTTACTGATAAAAAATCAGAGAATTCTTCAGCAGAATATTT
TTCGACACAAGCGCATAATCTCTTAACTGCTCTTCTTGCACATGTCATATTCTCTGACGAATACGAAGAC
AGTGAGCGTCATTTAAAAACGTTGCGCAAAATTCTTTCTCAATCAGAAACGGCTGTTGTTAATCAATTGC
GCAATATTCAAGATACATCACCTTCTCCTTTTATTCGTGAAATGGTTGGTATTTTCACAGAAATGGCAGA
TCAAACTTTTTCAGGTGTTTATACAACTGCCGCAAAAGATACTCAGTGGCTTTCTTTGTCCAATTACGCG
GATCTTGTTTGTGGTGATGATTTCTCATCCTCGGATATAGCAGATGGGAATACAGATATTTTTCTTAATC
TTCCTGCAAGTATTTTGAATAGTTATCCAGGAATTGGGCGTGTGATTATTGGTGCTTTTTTAAATGCAAT
GGTTACAGCAGATGGAAACTACAAAAAGCGTGTTTTGTTTGTCTTGGATGAGGTTGATTTGCTTGGTTAT
ATGAATATTTTGGAAGAAGCACGTGACCGTGGACGTAAATATGGCACATCCTTAATGTTATTTTATCAGT
CTTCTGGTCAGTTGGTAAATCACTTCGGAAAATCAGGAGCACAATCATGGTTTGAAAGTTGTTCGTTTGT
GAGTTATGCTGCTATTAAAGATTTACAAACAGCTAAAGATATTTCAGAACGTTGTGGTCAAATGACTATT
GAAGTGACAGGAGCAAGTAAATCTAGAGGGCAACTTTTAAAAGGTTCTAAAAATATGAATTATCAACAAA
GATCACTGATTTTGCCTCATGAAATTATTCAAGAGATGCGCCAAGATGAACAAATCATTCTCATGCAAGG
ACAACCACCTTTACGATGTGGACGAGCAATCTATTTTAGAAGAAAAGAACTGTTAGCTGCTACTGAAAAG
AATCGTTTTGCTCCAAAAGGGAAGTAA
 Primer design