SecReT4
Protein ID: 319898809
T4SS name [ID]VirB [231]
Gene symbolvirB11
Locus tagBARCL_0641
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]704616..705686 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDE6YHI4
KEGG IDbcd:BARCL_0641
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.5e-92, Aligned region: 20..333
Protein Sequence: 356 a.a.     [Download]
>gi|319898809|ref|YP_004158902.1| type IV secretion system protein VirB11 [Bartonella clarridgeiae 73]
MKQNSQNISDETVAIVSTKLKPIRTFLKDESLFEIVINRPYQVMIEGIKGWKTIEVPELSFNELIGIAKV
IAAYSKQNISDKNPILSATLPDNERIQIVIPPAVEKDTISITIRKPSSRNYSLEDLADKGLFSMCEQVSF
TSLNDYQSRFNELKSIERELVIDYYNKNFVSFLNQAVKLQKNILISGKTGSGKTTLSKALIAKIPNDERI
ITIEDTPELIVPHPNRVSMIYAKDGHGLASVGPKQLLESALRMRPDRILLQELRDGTAFYYIRNVNSGHP
GSITTVHASTALAAFEQMTLLVKESEGGADLERDDIRGLLISMVDVIIQCKRIEGKFKVTEIYYDPFKQR
NIFGGN
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c705686-704616 Bartonella clarridgeiae 73, complete genome
ATGAAGCAAAACTCTCAAAATATAAGTGATGAAACCGTCGCTATCGTCTCAACAAAACTCAAACCAATTC
GTACCTTTCTCAAAGATGAAAGTCTCTTCGAAATCGTCATTAATCGTCCCTATCAAGTCATGATCGAAGG
AATAAAAGGATGGAAAACAATCGAAGTTCCAGAACTCTCCTTTAATGAACTCATCGGTATCGCTAAAGTC
ATTGCCGCTTATTCTAAGCAAAATATTTCCGATAAAAATCCAATATTATCAGCTACCTTGCCGGATAACG
AGCGTATTCAAATTGTCATTCCACCAGCTGTAGAAAAAGACACAATCAGCATAACAATTCGTAAACCATC
GTCGCGAAATTATTCACTCGAAGATCTGGCTGATAAAGGTCTTTTTTCAATGTGTGAACAGGTCTCTTTC
ACCTCATTGAATGATTATCAATCGCGTTTTAATGAACTTAAAAGTATCGAACGTGAATTGGTAATCGATT
ATTACAATAAAAACTTTGTTTCTTTTTTAAATCAGGCTGTGAAATTGCAAAAAAATATCCTTATTTCAGG
AAAAACAGGGTCTGGTAAAACAACGCTTTCGAAAGCGTTGATCGCTAAAATTCCTAATGACGAGCGTATT
ATAACTATTGAAGATACACCAGAATTGATCGTGCCACATCCTAATCGTGTCTCTATGATCTACGCAAAAG
ATGGGCATGGTTTAGCTTCTGTTGGACCAAAACAGTTACTTGAATCTGCTTTACGAATGCGTCCTGACCG
TATTCTTCTACAAGAGTTGCGAGATGGTACTGCTTTTTATTATATCCGTAATGTTAATTCAGGACACCCA
GGTTCGATTACAACAGTTCATGCGTCAACAGCACTTGCTGCATTTGAGCAAATGACTCTGCTGGTCAAAG
AAAGTGAAGGAGGAGCCGATTTAGAGCGCGATGATATTCGAGGATTATTAATTTCAATGGTTGATGTTAT
CATTCAATGCAAACGGATCGAAGGAAAATTTAAGGTTACAGAAATTTATTATGATCCTTTCAAGCAACGA
AATATCTTTGGAGGTAATTAA
 Primer design