SecReT4
Protein ID: 319898810
T4SS name [ID]VirB [231]
Gene symbolvirB10
Locus tagBARCL_0642
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]705683..706963 [-]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDE6YFW5
KEGG IDbcd:BARCL_0072, bcd:BARCL_0627, bcd:BARCL_0642
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.4e-57, Aligned region: 196..393
Protein Sequence: 426 a.a.     [Download]
>gi|319898810|ref|YP_004158903.1| type IV secretion system protein VirB10 [Bartonella clarridgeiae 73]
MNDEMDEISFNDRDTIKDRNRTEDRDTIKDNQGKKESFNVGKAIALLILFSVCIYLMYAILSTSKDTKKQ
PIELPKETTNKQTELFQSVKPTLAPLELVDKNKTLLPKVELPTPTINQPESNNSDNKLLEAAQRAPVLAY
SNPNQQQANTANNNDNNGASPSQNNNPDKTAQQFNQLLKPTKLDGIRASTLGNRNYIIAMGASIPCILET
AVSSEQQGFVSCIVSRDILSDNGRVVLLDKGTQIVGEYRAGLKKGQTRLFVLWNRAKTPSGVIITLGSPA
TDALGRSGIDGDIDNHWFERLGSALLVSIVRDATNYANDWINLPKQQKEEKETTNILSAGADIFSSGTSG
IGTISAGVDMARMLAENYINIPPTLTKNQGEMINVFVVRDLDFSTVYKLKIIENNKQIIHRAFSGDFNKN
SMVTPK
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c706963-705683 Bartonella clarridgeiae 73, complete genome
ATGAATGATGAAATGGACGAAATAAGCTTCAATGATCGCGATACAATTAAGGATCGTAATAGGACAGAGG
ATCGCGATACAATAAAAGACAATCAAGGAAAAAAAGAGAGCTTTAATGTAGGAAAAGCCATTGCTCTTCT
TATCCTCTTCAGTGTCTGTATTTATTTAATGTATGCAATCCTTTCAACTTCAAAAGATACGAAGAAACAA
CCAATAGAATTGCCTAAAGAAACAACCAATAAGCAAACAGAGCTTTTCCAATCCGTCAAGCCGACGTTAG
CTCCTCTTGAGTTGGTTGACAAAAATAAAACCCTGTTGCCTAAAGTTGAACTACCAACGCCAACAATCAA
TCAACCAGAATCTAATAATAGTGATAATAAGTTGTTGGAAGCAGCACAACGAGCTCCCGTCTTGGCCTAT
TCAAATCCAAATCAGCAACAAGCTAATACAGCCAATAATAATGATAATAATGGTGCTTCTCCTTCCCAAA
ACAATAACCCCGATAAAACAGCACAACAGTTCAATCAGCTCCTCAAACCAACAAAGCTAGACGGTATTCG
CGCTTCAACACTCGGTAACCGAAATTACATCATTGCAATGGGAGCTTCTATCCCATGTATCTTAGAAACA
GCAGTTAGTAGTGAACAACAAGGTTTTGTCAGTTGTATCGTTTCCAGAGATATCTTGTCAGACAATGGTC
GTGTCGTCTTGCTCGATAAAGGAACACAAATCGTCGGTGAATATCGTGCCGGCTTAAAAAAAGGTCAAAC
GCGTCTCTTCGTATTGTGGAATAGAGCCAAAACACCAAGTGGTGTCATTATAACATTGGGCTCACCAGCA
ACAGATGCTTTAGGTCGCTCCGGTATCGATGGTGATATTGATAATCATTGGTTTGAACGCCTCGGTTCCG
CACTTCTTGTATCAATCGTTAGAGATGCAACAAATTATGCAAACGACTGGATAAATTTACCAAAACAACA
AAAGGAAGAAAAAGAAACAACAAACATTCTCTCTGCAGGAGCAGATATATTCTCTTCAGGAACATCAGGA
ATAGGGACCATCTCTGCAGGAGTAGATATGGCCAGAATGCTCGCAGAAAATTACATCAATATCCCTCCAA
CCCTAACTAAAAATCAGGGTGAAATGATCAATGTCTTTGTGGTGCGCGACCTCGATTTCTCCACTGTGTA
CAAATTAAAAATTATCGAAAATAACAAACAGATTATTCATCGTGCCTTTTCAGGGGACTTCAATAAAAAC
TCTATGGTAACTCCCAAATGA
 Primer design