SecReT4
Protein ID: 319898811
T4SS name [ID]VirB [231]
Gene symbolvirB9
Locus tagBARCL_0643
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]706960..707820 [-]
Producttype IV secretion system protein VirB9 protein
Component typeVirB9
UniProt IDE6YFW6
KEGG IDbcd:BARCL_0073, bcd:BARCL_0626, bcd:BARCL_0643
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.9e-57, Aligned region: 34..258
Protein Sequence: 286 a.a.     [Download]
>gi|319898811|ref|YP_004158904.1| type IV secretion system protein VirB9 protein [Bartonella clarridgeiae 73]
MIRVKIFFLTLIVAISCHASVSWAEISPVSAHKDNRIRFINYDPYNVTKIIGSIRSSVQIEFANDENIAY
IGIGNSVAWQVAPAGHFVFLKPREVQPTTNLQIVTTRPDGTKRSYQFELQVRKGDVSVGNDTYFLVKFRY
PEDEALRKKLAEEAKVQQKEEEFVDDILNMHEHFGPRNWAYVAQGSPIIEPTSVYDNGKTTTFTFLGNNE
IPAIYLVSLDGQESIVPKSIKGNQVIVHAIAMQFTLRRGNEVLCIYNKGFIPRGINPETGTTSPSVQREV
NVGKQP
 
Nucleotide Sequence: 861 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c707820-706960 Bartonella clarridgeiae 73, complete genome
ATGATCAGAGTAAAAATATTCTTTTTAACTCTCATTGTTGCAATAAGTTGTCATGCATCAGTGTCATGGG
CAGAAATCTCTCCCGTTAGTGCACACAAAGATAATCGCATCAGATTTATCAACTATGACCCATACAATGT
CACAAAAATCATTGGGTCTATTCGCTCCTCAGTGCAAATTGAATTCGCTAACGATGAAAACATTGCTTAT
ATTGGAATTGGCAATTCCGTTGCTTGGCAAGTCGCCCCAGCCGGTCACTTTGTCTTCCTTAAACCGCGCG
AAGTTCAGCCCACCACCAATCTACAAATCGTCACAACCCGTCCAGACGGAACAAAACGATCTTATCAATT
TGAACTTCAGGTGCGTAAAGGTGATGTCTCCGTTGGCAATGATACATATTTCCTTGTAAAGTTTCGTTAT
CCAGAAGATGAAGCCTTGCGTAAAAAATTAGCCGAAGAAGCCAAAGTCCAACAAAAGGAAGAAGAGTTTG
TAGATGATATCTTAAATATGCACGAACATTTTGGACCACGCAATTGGGCTTATGTCGCTCAAGGTTCACC
CATCATTGAACCAACCTCCGTCTATGATAACGGCAAAACAACAACATTTACCTTTTTAGGAAATAACGAA
ATTCCTGCCATTTATCTTGTCTCACTTGATGGACAAGAATCTATCGTTCCAAAATCTATTAAAGGAAACC
AGGTCATTGTTCATGCCATAGCCATGCAATTCACTTTGCGGCGCGGTAATGAAGTCCTGTGTATCTATAA
TAAAGGATTCATACCAAGAGGAATTAACCCCGAAACCGGTACAACATCACCTTCTGTCCAACGTGAAGTG
AACGTAGGGAAACAGCCATGA
 Primer design