SecReT4
Protein ID: 319898814
T4SS name [ID]VirB [231]
Gene symbolvirB6
Locus tagBARCL_0646
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]708991..709983 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDE6YFW9
KEGG IDbcd:BARCL_0076, bcd:BARCL_0623, bcd:BARCL_0646
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.5e-34, Aligned region: 44..261
Protein Sequence: 330 a.a.     [Download]
>gi|319898814|ref|YP_004158907.1| type IV secretion system protein VirB6 [Bartonella clarridgeiae 73]
MSDFKFTPFASVSSYILIPLNDVVDSTVSSLSSAVAAPLNLAAIIFIFLYGYNVMTGHVALSMHSLLNNV
VKIIIVTTMATNADVFNTYVKGIFFGNLANAIGNAFNSNPVDADVFDYILLMANTRYQDFVAKAWLFDKI
IVGLIGGLMFLAIIVFCTIGFIIQMFAKITLVMVISLGPIFISLYLFNVTRRYADAWISTLVNFTVLQVL
VMFLGTMMCKITLYVFDSPYSSIYFLLPPVLVVSIVGSTLFQSLPTIASALSSGGPYHHAGTSAGSQMFS
IASNALNLAGRGLNLGGSAARHTASGASSAAAQAAQAAQMMRGGGGRGPF
 
Nucleotide Sequence: 993 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c709983-708991 Bartonella clarridgeiae 73, complete genome
ATGTCAGATTTTAAATTTACCCCATTCGCAAGTGTTTCTTCATATATTTTAATACCACTCAACGATGTGG
TGGATTCAACAGTTAGTAGTTTGTCTTCTGCTGTTGCAGCACCATTAAATCTTGCGGCAATCATTTTTAT
CTTTTTATATGGCTACAATGTTATGACTGGCCACGTCGCCCTTTCAATGCATAGCCTTCTGAATAATGTC
GTCAAAATCATTATCGTGACAACAATGGCAACAAATGCAGATGTATTTAATACTTACGTCAAAGGTATAT
TTTTCGGTAATTTAGCAAATGCTATTGGAAATGCATTCAATAGTAATCCGGTTGATGCCGATGTCTTCGA
TTATATTTTGTTAATGGCAAATACTCGTTATCAAGATTTTGTAGCTAAAGCTTGGCTTTTTGACAAGATT
ATAGTTGGACTGATTGGCGGTTTAATGTTTTTAGCAATTATTGTTTTTTGTACAATTGGCTTTATTATCC
AAATGTTTGCAAAAATCACATTGGTAATGGTAATAAGTCTTGGACCTATTTTCATTAGTTTATATTTATT
CAATGTAACCAGAAGATACGCCGATGCATGGATTTCAACATTGGTTAATTTTACGGTTTTACAAGTTCTC
GTAATGTTTCTGGGAACAATGATGTGCAAAATTACTTTGTATGTTTTCGATAGCCCATATAGTTCAATCT
ATTTCCTGCTGCCCCCTGTCTTGGTAGTCTCAATAGTAGGAAGTACTCTCTTCCAATCACTTCCCACCAT
TGCCTCTGCACTCTCTAGTGGAGGACCATATCACCATGCCGGAACATCCGCAGGATCACAAATGTTCTCG
ATTGCTTCTAACGCCTTAAACTTGGCTGGAAGAGGCTTAAACCTGGGTGGAAGTGCAGCAAGACATACAG
CTTCAGGAGCTTCTAGCGCCGCTGCACAAGCTGCACAAGCTGCACAAATGATGCGTGGAGGGGGTGGTCG
TGGTCCATTTTAA
 Primer design