SecReT4
Protein ID: 319898816
T4SS name [ID]VirB [231]
Gene symbolvirB4
Locus tagBARCL_0648
StrainBartonella clarridgeiae 73
Repliconchromosome [GenBank: NC_014932] [Browse all T4SS(s) in this replicon]
Location [Strand]710420..712774 [-]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDE6YFX1
KEGG IDbcd:BARCL_0078, bcd:BARCL_0621, bcd:BARCL_0648
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.4e-68, Aligned region: 173..376
AAA_10 [PF12846], Evalue: 1.1e-40, Aligned region: 429..707
Protein Sequence: 784 a.a.     [Download]
>gi|319898816|ref|YP_004158909.1| type IV secretion system protein VirB4 [Bartonella clarridgeiae 73]
MSVMKRESLPEEYIPYVRHVNQRVIALNSRCLMTVIAIEGINFDTADITQLNSLHTQLNTLLKNIADERV
ALYSHIIRRRETIYPESQFFSSFATVLDEEYKQKMISKDLYRNDLYLSILWNPAADKTEQLATFFHRLTQ
AKKTQSEPDFEAIRKLEELSQDLIQGLESYEARLLSTYEHDGILFSEQSEFLHQLVGGRRERIPLTFGTI
ASTIYSDRVLFGKEIIEIRHESNERFVGMFGWKEYPSKTRPGMTDGLLTAPFELILTQSFVFKSKAVASA
IMSRKQNQMINVADRASSQIGALDDALDDLESNRFVLGEHHLSLAVFSDHPQELAEHLSKARSYLTNGGA
VIAREDLGLEAAWWAQLPGNFSYRARSGAISSRNFAALSPFHSFPIGKLKGNVWGSAVALLQTQAGSPYY
FNFHYGDVGNTFVCGPSGSGKTVIVNFLLAQSQKYNPTIVFFDKDQGAEIFVRAGGGKYKPLKNGKPTNI
APLKGMEYTEKNKLFLQHWVLKLVTTEGQTVTEQERQDVARAINSLESLPLEQRSLGALQLFFDNTSTEG
IAMRLKRWIKGNALGWVFDNDHDDLNLDAQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRIIIVI
DEFWKALEDDSFKAFTQDRLKTIRKQNGMMLFATQSPRDALNSTIAHTIIEQCPTQIFFPNQKANYNDYV
ENFKLTEREFELIQSELSRESRRFLIKQGQNSIVAELNLRGMDNEIAVLSGTTRNIELLNQIIGEYGTNP
DIWLPIFHQRRRTQ
 
Nucleotide Sequence: 2355 bp     [Download]
>gi|319898193|ref|NC_014932.1|:c712774-710420 Bartonella clarridgeiae 73, complete genome
ATGTCAGTGATGAAGCGGGAATCTTTGCCTGAGGAATATATTCCCTATGTTCGTCATGTCAATCAACGTG
TAATTGCGTTGAATTCACGCTGCTTAATGACAGTGATTGCTATTGAAGGTATCAATTTTGATACTGCAGA
TATCACTCAATTAAATTCCTTACATACCCAATTAAACACACTCTTGAAAAATATTGCAGATGAACGTGTT
GCTTTATATTCTCATATCATTCGGCGACGGGAAACGATTTATCCAGAGAGCCAATTTTTTTCATCTTTTG
CAACAGTCTTAGATGAAGAATACAAACAGAAAATGATTTCGAAAGATCTTTATCGGAATGATTTGTATCT
TTCGATACTCTGGAATCCTGCAGCGGATAAAACTGAACAGTTGGCTACTTTTTTTCATCGCTTAACACAA
GCCAAGAAGACACAATCGGAACCAGATTTTGAAGCTATTCGGAAACTCGAAGAGTTAAGCCAAGATCTTA
TACAAGGTCTGGAGAGCTATGAAGCACGGCTTTTGTCAACCTACGAACATGATGGGATTTTATTTTCTGA
ACAAAGTGAATTTCTTCACCAGTTAGTGGGAGGAAGGCGTGAACGCATTCCCCTTACATTTGGGACTATT
GCCTCAACGATTTACTCAGATCGGGTTCTTTTTGGAAAAGAAATTATTGAAATTCGTCATGAAAGCAATG
AACGCTTTGTAGGTATGTTTGGATGGAAGGAATATCCCTCTAAAACGCGTCCAGGTATGACGGATGGTTT
GTTGACAGCGCCCTTTGAATTGATCTTAACGCAATCCTTTGTTTTTAAAAGTAAAGCAGTTGCAAGTGCT
ATTATGAGCCGTAAACAAAATCAAATGATTAATGTGGCTGATCGAGCCAGCTCACAAATTGGTGCACTTG
ATGATGCACTTGATGATTTAGAATCTAATCGTTTTGTTTTGGGAGAACATCATCTCTCTTTAGCCGTTTT
TTCTGATCATCCACAAGAATTAGCAGAACACCTCTCCAAAGCTCGTTCTTACCTGACGAACGGTGGAGCA
GTTATAGCCAGAGAAGATCTAGGATTAGAGGCAGCATGGTGGGCTCAGCTTCCTGGAAACTTTAGCTATC
GAGCACGCTCTGGAGCCATTAGCAGCAGAAATTTTGCAGCCTTATCCCCGTTTCATTCCTTCCCTATTGG
CAAATTGAAAGGCAATGTTTGGGGTTCTGCCGTTGCTTTACTGCAAACACAAGCTGGTTCGCCTTACTAT
TTTAATTTTCATTATGGTGATGTTGGAAATACCTTTGTTTGCGGACCATCAGGCTCTGGGAAAACAGTTA
TTGTTAATTTTCTGCTTGCACAATCGCAAAAATATAACCCAACAATAGTCTTTTTCGATAAAGATCAGGG
CGCAGAAATCTTTGTACGTGCTGGAGGTGGAAAATATAAGCCTTTGAAAAACGGCAAACCTACCAATATT
GCACCATTAAAAGGCATGGAATACACCGAAAAAAATAAACTCTTTCTTCAACACTGGGTCTTAAAATTAG
TCACCACCGAAGGCCAAACAGTGACAGAACAAGAACGACAAGACGTTGCTAGAGCAATTAATTCCTTAGA
AAGCCTTCCCCTAGAACAACGCTCTCTCGGTGCACTTCAACTGTTTTTTGATAATACATCTACAGAAGGT
ATTGCCATGCGTTTAAAACGTTGGATCAAAGGCAATGCTTTAGGGTGGGTTTTTGATAATGATCACGATG
ATCTCAATTTAGATGCCCAATTCATAGGTTATGATATGACGGATTTCTTAGATAATGAAGAAATTCGTCG
CCCTTTGATGATGTATCTGTTTAACCGCATCCTCGATCTTATTGATGGTCGGCGTATCATTATCGTTATC
GATGAATTCTGGAAAGCTCTCGAAGATGATTCATTTAAAGCTTTTACCCAAGATCGTCTCAAAACAATTC
GTAAACAAAATGGTATGATGCTCTTTGCAACACAAAGCCCTAGAGATGCTTTGAATTCAACCATTGCCCA
CACAATTATTGAACAATGCCCCACCCAAATATTTTTTCCAAATCAAAAAGCTAATTACAACGATTATGTT
GAAAACTTTAAACTGACTGAACGTGAATTTGAATTAATCCAATCAGAATTAAGCAGAGAATCTCGGCGTT
TTCTCATTAAACAAGGACAAAATTCCATTGTTGCAGAACTCAACTTACGGGGAATGGATAACGAAATTGC
TGTCTTAAGCGGAACAACCAGAAATATCGAACTCTTGAATCAAATTATAGGTGAATATGGAACCAATCCG
GATATATGGCTGCCTATATTTCATCAAAGGAGACGAACGCAATGA
 Primer design