SecReT4
Protein ID: 324120145
T4SS name [ID]Tra_F [125]
Gene symboltraL
Locus tagpc15-k-055
StrainKlebsiella pneumoniae plasmid pc15-k (NC_015154)
Repliconplasmid pc15-k [GenBank: NC_015154] [Browse all T4SS(s) in this replicon]
Location [Strand]62125..62430 [+]
ProductIncF plasmid conjugative transfer pilus assembly protein
Component typeTraL_F
UniProt IDD5KTR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-38, Aligned region: 8..101
Protein Sequence: 101 a.a.     [Download]
>gi|324120145|ref|YP_004249906.1| IncF plasmid conjugative transfer pilus assembly protein [Klebsiella pneumoniae]
MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSKFIFGIASAVLVFWGIKKLKKGRGSSW
LRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK
 
Nucleotide Sequence: 306 bp     [Download]
>gi|324120092|ref|NC_015154.1|:62125-62430 Klebsiella pneumoniae plasmid pc15-k, complete sequence
ATGACGGGAGACGAATTAAAGCGATACCGTTTCCCGGAAACACTGACTAACCAGTCCCGCTGGTTTGGCT
TATATCTCGATGAACTTATCCCGGCCGTGATTTGTCTCGGCTGGGGTTTCTGGACCAGCAAGTTCATATT
TGGCATAGCTTCAGCGGTACTGGTTTTCTGGGGTATCAAGAAACTGAAAAAAGGGCGGGGCAGTTCCTGG
CTACGCGACCTGATTTACTGGTATCTGCCAACCTCCCTTCTTAAAGGTTTCTTTCATGATGTTCCGGACT
CCTGTTTCCGGCAGTGGATTAAATAA
 Primer design