SecReT4
Protein ID: 324120164
T4SS name [ID]Tra_F [125]
Gene symboltraX
Locus tagpc15-k-079
StrainKlebsiella pneumoniae plasmid pc15-k (NC_015154)
Repliconplasmid pc15-k [GenBank: NC_015154] [Browse all T4SS(s) in this replicon]
Location [Strand]94147..94872 [+]
ProductIncF plasmid conjugative transfer pilin acetylase
Component typeTraX_F
UniProt IDD4HQM6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 5.6e-51, Aligned region: 25..239
Protein Sequence: 241 a.a.     [Download]
>gi|324120164|ref|YP_004249930.1| IncF plasmid conjugative transfer pilin acetylase [Klebsiella pneumoniae]
MRAQHTFPGATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGLLLAGNNEVMRLLGRGCFPLFGLAWGM
NLARHAEIRQSQLNSLWGWALVAQVSFMLIGYPWYTGNILFAFAVTGQVLRWVSQPSWYYTLPAAGLLVT
WIPLSTGSYGMAGVGMLTASWLLCRAQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSS
AGERVKRFWPRQFFVMFYAVHLAVLGIVVSM
 
Nucleotide Sequence: 726 bp     [Download]
>gi|324120092|ref|NC_015154.1|:94147-94872 Klebsiella pneumoniae plasmid pc15-k, complete sequence
ATGAGAGCACAACACACATTTCCAGGCGCGACAGACAGCTGGCTTCAGCGCCTGCTGACCTGGACACCGG
GACAAACGGATATGATTAAAACGGTCGCACTGGTACTGATGGTGACTGACCACACCGGCTTACTGCTGGC
CGGAAACAATGAAGTGATGCGCCTGCTGGGACGTGGTTGTTTTCCGCTGTTCGGTCTGGCATGGGGAATG
AATCTGGCACGGCACGCGGAAATACGCCAGTCTCAACTGAACAGCCTGTGGGGCTGGGCGCTGGTCGCCC
AGGTGTCGTTTATGCTCATCGGGTACCCGTGGTATACCGGGAATATTCTGTTTGCCTTTGCCGTTACGGG
CCAGGTCCTGCGGTGGGTCAGCCAGCCGTCCTGGTATTACACCCTCCCGGCGGCTGGACTGCTGGTCACC
TGGATACCCCTGTCAACCGGCAGCTACGGCATGGCCGGAGTGGGCATGCTCACCGCCAGCTGGCTGCTTT
GTCGCGCACAGCATGCACCGGAACGGCTGGGATACGGGGTGTTGTGGGCCCTCATGGTGTTGCTGATGAA
TATGCATGACGTGAGTGAATCAGTGGCCGGACTGGCGATTGCGCTGCTGACGCTGATGGTGTGCTCATCT
GCCGGAGAACGTGTGAAACGCTTCTGGCCGCGGCAGTTCTTCGTGATGTTCTATGCCGTGCACCTGGCGG
TACTGGGTATTGTCGTCTCAATGTGA
 Primer design