SecReT4
Protein ID: 32455871
T4SS name [ID]Trb [63]
Gene symboltrbC
Locus tagpADP-1_p087
StrainPseudomonas sp. ADP plasmid pADP-1 (NC_004956)
Repliconplasmid pADP-1 [GenBank: NC_004956] [Browse all T4SS(s) in this replicon]
Location [Strand]86768..87232 [-]
ProductTrbC protein
Component typeTrbC
UniProt IDQ79BP7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 12..110
Protein Sequence: 154 a.a.     [Download]
>gi|32455871|ref|NP_862524.1| TrbC protein [Pseudomonas sp. ADP]
MQATFPAFRLNRNALFYMGLFALLAFFLLAPQHAFASEGTGGSLPYESWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGALHQVKVAALDVAGFPG
EAVMRWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|32455785|ref|NC_004956.1|:c87232-86768 Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence
ATGCAAGCAACCTTCCCGGCATTCCGCCTCAACCGCAACGCCCTGTTCTACATGGGCCTCTTCGCCCTCC
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCATTCGCCTCCGAGGGCACCGGCGGCTCTCTGCCGTATGA
GAGCTGGCTGACCAACCTCCGCAACTCCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTGGTCGCCGGCGGCATCCTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACGTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGCGCTGCACCAGGTCAAGGTCGCCGCGCTGGACGTGGCCGGCTTCCCCGGC
GAAGCCGTCATGCGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design