SecReT4
Protein ID: 32469826
T4SS name [ID]Cjp [603]
Gene symbolvirB8
Locus tagpVir_p01
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pVir (NC_005012)
Repliconplasmid pVir [GenBank: NC_005012] [Browse all T4SS(s) in this replicon]
Location [Strand]1..678 [+]
ProductVirB8
Component typeCjp01
UniProt IDQ9KIS2
KEGG IDcjj:CJJ81176_pVir0001
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.4e-31, Aligned region: 23..208
Protein Sequence: 225 a.a.     [Download]
>gi|32469826|ref|NP_863298.1| VirB8 [Campylobacter jejuni subsp. jejuni 81-176]
MAFIDDKKDPNFIFQLERNIKAYMLYIIIALTTIVVSLAIAITFLAPFKEVKPYLVFFSDGETNFVKVEQ
AGMDMRADENLLKSILAGYVKKRETINRVDDSERYEEIRLQSQKNVWETFSNLVKAPNSIYTTQGVFRSI
EIINVSIFNKNVATIDFIAKITNRDGSENHLKKYRATLFFDFIPMELTYNSVPKNPTGFIVKQYSITDII
DNDTFNNTQQTKGAK
 
Nucleotide Sequence: 678 bp     [Download]
>gi|32469825|ref|NC_005012.1|:1-678 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGGCTTTTATTGACGATAAAAAAGATCCAAATTTTATATTTCAACTTGAGAGAAATATAAAAGCGTATA
TGCTATACATTATTATAGCTTTAACTACGATTGTAGTTTCTCTTGCTATTGCCATTACTTTTCTTGCCCC
TTTTAAAGAAGTAAAGCCTTATTTAGTATTTTTTTCAGACGGCGAAACTAATTTTGTAAAGGTAGAACAA
GCAGGAATGGATATGAGAGCCGATGAGAATTTATTAAAATCAATTCTCGCAGGCTATGTTAAAAAACGCG
AAACGATAAATCGTGTCGATGATAGTGAGAGATACGAAGAGATCAGACTTCAATCTCAAAAAAATGTGTG
GGAAACATTCTCAAACTTAGTAAAAGCTCCAAATTCTATTTATACAACGCAAGGAGTTTTTAGAAGCATT
GAAATTATCAATGTTTCAATTTTTAATAAAAATGTAGCTACGATCGATTTTATAGCAAAAATAACTAATA
GAGATGGTAGTGAGAACCATTTAAAAAAATATCGTGCCACATTATTTTTTGATTTTATACCAATGGAGCT
TACTTATAATTCAGTTCCAAAAAATCCTACAGGCTTTATTGTCAAACAATATTCAATTACAGACATTATT
GACAATGATACTTTTAACAATACACAACAAACGAAAGGAGCGAAGTAA
 Primer design