SecReT4
Protein ID: 32469831
T4SS name [ID]Cjp [603]
Gene symbolvirD4
Locus tagpVir_p06
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pVir (NC_005012)
Repliconplasmid pVir [GenBank: NC_005012] [Browse all T4SS(s) in this replicon]
Location [Strand]4452..6338 [+]
ProductVirD4
Component typeCjp06
UniProt IDQ8GJE7
KEGG IDcjj:CJJ81176_pVir0007
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-72, Aligned region: 137..568
TrwB_AAD_bind [PF10412], Evalue: 8.7e-28, Aligned region: 315..516
TraG-D_C [PF12696], Evalue: 1.6e-25, Aligned region: 420..536
Protein Sequence: 628 a.a.     [Download]
>gi|32469831|ref|NP_863303.1| VirD4 [Campylobacter jejuni subsp. jejuni 81-176]
MNDKKITPAKWVLMFITSIILGIILYLLMVKIIFKPDLLVTHQVGLQIIHNLGNPALKLKAYVAVFALIL
PFIVCLIWFFMPQMNLKENYGNARFAKEKDFEEMNICNDRGLILGCNIKKGIKGDEIEYIRAKMPLSALV
VAPPGTGKTSGIILPNLFTVPNSTLALDIKGELYAKSAGYRKKYFNNEILLFEPFSDNNTLFFNPFDNSI
VKDMNFIQMMKLADQIAGTIFVAEKGKEGDHWVTSAKTLFTFFALYNMQKHKHTSLGDLTQAPKKDYFNE
LNEEFGKECLIEDEDTGEVSRDYNVDTFKVFLKQVANDENLDEIVRNQARAYQTAAEQEFASIKSTYDTY
MKVFTNPQVANATSKMNFRFEDLREKRITMYVVIQTEDMDILAPLVRIFIESLFKKLMSGQENSNPDKFI
YCLLDEFVRFGKMPFLLEAPALCRSYGLIPVFVTQSYEQIRKYYGEDDLGIIRANAGYQTIFRMNTEKDA
KEISDLIGDFTREKTSSSKGTFDFFKSNNTVSKEGYKLITSQDIKNQSSEDILILVTGFLSRPIKAKVPY
WFKNPKLKGADKISLEDNNTNTEGESKNDEINNDDSQNVNQEQNFTQENSSSKQIFELEELGIKVKKE
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|32469825|ref|NC_005012.1|:4452-6338 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGAATGATAAGAAAATAACCCCTGCAAAATGGGTATTAATGTTTATAACTAGCATTATTTTAGGAATAA
TTCTTTATTTATTAATGGTAAAAATTATTTTCAAACCTGATTTATTAGTAACACATCAAGTTGGGTTACA
AATAATTCATAATTTAGGAAACCCTGCATTAAAACTTAAAGCTTATGTAGCAGTTTTTGCTCTCATTTTG
CCTTTTATAGTCTGTTTGATTTGGTTTTTTATGCCACAAATGAATTTAAAAGAAAATTACGGAAATGCAA
GATTTGCTAAAGAAAAAGATTTTGAAGAAATGAATATTTGCAATGATAGGGGTTTAATTTTAGGTTGTAA
TATTAAAAAAGGTATAAAAGGCGATGAAATAGAATACATCAGAGCTAAAATGCCCCTAAGTGCGTTGGTG
GTTGCACCACCAGGCACAGGTAAGACTTCAGGTATCATTTTACCTAATTTATTTACAGTTCCTAATTCTA
CTTTAGCACTTGATATTAAAGGCGAACTTTATGCAAAAAGTGCAGGTTATAGAAAAAAATATTTTAATAA
TGAAATTTTATTATTTGAACCTTTTTCAGATAATAATACTTTATTTTTCAACCCTTTTGATAATTCTATA
GTTAAAGATATGAATTTTATCCAAATGATGAAATTAGCAGATCAAATCGCAGGAACTATATTTGTAGCTG
AAAAAGGGAAAGAAGGCGATCATTGGGTTACAAGTGCGAAAACTCTTTTCACTTTTTTTGCATTATACAA
TATGCAAAAACACAAACATACGAGTTTAGGAGATTTAACTCAAGCTCCAAAAAAAGATTATTTTAATGAG
TTAAATGAAGAATTCGGAAAAGAGTGTTTAATTGAAGATGAAGACACAGGAGAAGTTTCAAGAGATTATA
ATGTAGATACTTTCAAAGTATTTTTAAAACAAGTGGCTAATGATGAAAATCTTGATGAGATCGTTAGAAA
TCAAGCAAGGGCTTATCAAACGGCTGCCGAGCAAGAATTTGCAAGTATTAAATCAACTTATGATACTTAT
ATGAAAGTTTTCACTAATCCACAAGTGGCTAATGCAACTTCAAAAATGAATTTTAGATTTGAAGATTTAA
GAGAAAAAAGAATTACTATGTATGTAGTAATACAAACCGAAGATATGGATATATTAGCTCCTTTGGTGCG
TATTTTTATCGAAAGTTTATTTAAAAAACTAATGAGCGGACAAGAAAATTCTAATCCTGACAAATTCATT
TATTGCTTATTAGATGAATTTGTGAGATTTGGAAAAATGCCTTTTTTACTTGAAGCACCTGCATTATGTA
GATCTTATGGACTTATTCCTGTATTTGTTACTCAATCATACGAGCAAATTAGAAAATATTATGGCGAAGA
TGATTTAGGAATTATTAGAGCAAATGCAGGTTATCAAACTATTTTTAGAATGAATACAGAAAAAGACGCT
AAAGAAATTAGCGATCTAATCGGCGATTTTACCAGAGAAAAAACATCATCATCAAAAGGAACTTTTGATT
TCTTTAAAAGTAATAACACTGTATCCAAAGAAGGTTATAAATTGATAACTTCACAAGATATTAAAAATCA
ATCCAGTGAAGATATTTTGATTTTAGTAACAGGATTTTTATCAAGACCTATTAAAGCTAAAGTGCCTTAT
TGGTTTAAAAATCCAAAACTTAAAGGAGCGGATAAGATTTCTTTAGAAGATAATAATACTAATACGGAAG
GAGAAAGCAAAAATGATGAGATTAATAATGATGATAGCCAAAATGTTAATCAAGAACAAAACTTTACTCA
AGAAAATTCAAGCTCTAAACAAATTTTCGAACTTGAAGAACTAGGAATAAAGGTAAAAAAAGAATAA
 Primer design