SecReT4
Protein ID: 32469876
T4SS name [ID]Cjp [603]
Gene symbolvirB4
Locus tagpVir_p53
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pVir (NC_005012)
Repliconplasmid pVir [GenBank: NC_005012] [Browse all T4SS(s) in this replicon]
Location [Strand]34857..37325 [+]
ProductVirB4
Component typeCjp53
UniProt IDQ8GJA2
KEGG IDcjj:CJJ81176_pVir0053
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.9e-30, Aligned region: 211..409
AAA_10 [PF12846], Evalue: 1.2e-28, Aligned region: 466..742
TrwB_AAD_bind [PF10412], Evalue: 7.8e-10, Aligned region: 635..775
AAA_17 [PF13207], Evalue: 9.3e-06, Aligned region: 471..555
Protein Sequence: 822 a.a.     [Download]
>gi|32469876|ref|NP_863348.1| VirB4 [Campylobacter jejuni subsp. jejuni 81-176]
MGTSIFTYLKELKNKPKKENLGKKEKKNFKEYINKINRGADNILMLAEPKIFTMAKENNIAFKLDENILV
TKDGNLCVGIEIKGISYSGISLEEEISYLQSRTQFFGKISSDIEINLIVKKDRIELVKQNSNSKNVFANQ
IIEKWENHKDAFQITYFLIISTIDKKISGALESFKNKTTKEKEQSKEEKESFSFEAKKIIINETLTEAKR
ALSIFNPTQITADDILNFYATYSNAQETKFRYTNELITDSYISSNVEFKKDYILFERNDGKQMFSRFISI
KAYETDIISSHITTKILRSSSDFIIFMNMQAYEKEKAIKKVKDTGAFAPQIIKDELSGLIEIIKADRENL
MLVSFSVYILAENLEDLETKTNELKGILANQNLNIVRETINQKALYFSFFPSRANLNARKRTLKVSNLAS
IANFEKDVLGFAKNDWGEQPVTIFRHLSGTPYLFNFHWTDQGDKPSGHTMIIGGTGAGKTTLAQFLMCNL
YKYDIDIFSMDKLRGMYNFATYTDGEYHDADFSDFKLNPFALPYTSENKSFLQNFIQKMANIEDTQYNAV
NEISKTIERLYNNKLEEDIFTLSDFIDSLQYEENDIKGRLRPFQNSIFDNKQDALSFNKQLSILNMDSIL
KNPTLASLTASYIFHRLKNSAKNSKKRGFFCFIDELKDFLMDENMRESILESILEVRKIGGVMCMGFQNL
SFFDDIPKGASFLENIANYIIFPTTNAQTLENMRNKLNLTPTELKFLQEAGTNSRQVLLKMNLSNQSAIL
NIDLSRLGKHLRVFSSSSDNVMLMKELKELYPNDWRNMYLENQKPNLNQGAK
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|32469825|ref|NC_005012.1|:34857-37325 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGGGAACGAGTATTTTTACTTATTTAAAAGAACTTAAAAATAAACCTAAAAAAGAAAATTTAGGAAAGA
AAGAAAAGAAAAATTTCAAAGAATATATCAATAAAATAAATAGGGGTGCTGACAATATTTTAATGTTAGC
AGAACCAAAAATTTTTACAATGGCTAAAGAAAATAACATAGCTTTTAAGCTTGATGAAAATATTTTAGTT
ACAAAAGATGGAAATTTATGTGTTGGAATTGAGATCAAAGGAATTTCTTATTCCGGAATTTCTTTAGAAG
AAGAAATATCTTATCTTCAAAGCCGAACACAATTTTTTGGAAAAATTAGTTCTGATATAGAAATCAATTT
GATTGTTAAAAAAGATAGAATTGAATTAGTAAAGCAAAATTCTAACTCCAAAAATGTTTTTGCCAATCAA
ATTATAGAAAAATGGGAAAATCATAAAGACGCTTTCCAAATAACTTACTTCCTAATCATATCAACTATTG
ACAAAAAAATAAGTGGAGCTTTGGAAAGTTTTAAGAACAAAACAACCAAAGAAAAAGAGCAAAGTAAGGA
AGAAAAAGAAAGTTTTAGTTTTGAAGCTAAAAAAATTATCATAAATGAAACTTTGACTGAAGCAAAAAGA
GCTTTGTCTATATTTAATCCAACTCAAATCACGGCTGATGATATTTTAAATTTCTATGCAACCTACTCAA
ACGCACAAGAAACTAAATTTAGATATACAAACGAACTAATCACTGATAGTTACATTAGCTCTAATGTAGA
ATTTAAAAAAGATTATATTTTATTTGAAAGAAATGATGGAAAACAAATGTTTTCAAGGTTTATAAGCATT
AAAGCTTATGAAACTGACATAATATCTTCTCATATAACTACAAAAATTCTAAGAAGCTCCAGTGATTTTA
TAATTTTTATGAATATGCAAGCTTATGAAAAAGAAAAGGCGATAAAAAAGGTAAAAGACACAGGAGCATT
TGCACCACAAATCATAAAAGATGAACTTAGCGGACTTATTGAAATAATAAAAGCCGATAGAGAAAATTTA
ATGCTTGTGAGCTTTTCAGTTTATATTTTGGCTGAAAATTTAGAAGATTTAGAAACTAAAACAAACGAGC
TTAAAGGAATTTTAGCAAACCAAAACCTAAACATCGTTCGAGAAACCATAAATCAAAAGGCTTTATACTT
CTCATTTTTTCCAAGCAGAGCAAACTTAAACGCTAGGAAAAGAACCCTAAAGGTTTCAAATTTAGCTAGC
ATAGCCAATTTTGAAAAAGATGTCTTAGGTTTTGCAAAAAATGATTGGGGCGAACAGCCAGTAACTATTT
TTAGACATTTAAGTGGAACTCCTTATCTTTTTAATTTTCATTGGACGGATCAAGGAGATAAGCCAAGCGG
ACATACTATGATTATAGGTGGAACAGGTGCAGGAAAAACAACATTAGCTCAATTTTTAATGTGTAATCTT
TATAAGTATGATATTGATATTTTTTCTATGGATAAGCTTCGCGGTATGTATAATTTCGCAACTTATACAG
ACGGAGAGTATCACGACGCTGATTTTAGTGATTTTAAACTAAATCCGTTTGCATTGCCTTATACAAGTGA
AAATAAGTCTTTTTTACAAAACTTTATTCAAAAAATGGCTAATATAGAAGACACTCAATACAATGCCGTA
AATGAAATTTCAAAGACTATAGAAAGGCTTTATAATAATAAACTTGAAGAAGATATCTTTACCTTAAGCG
ATTTTATCGACAGTCTTCAGTACGAAGAAAATGATATTAAAGGACGACTAAGACCTTTTCAAAATAGTAT
TTTTGATAATAAGCAAGATGCTTTAAGTTTCAACAAACAATTATCAATTCTAAATATGGATAGCATTTTA
AAAAATCCTACACTAGCAAGCCTAACGGCTTCTTACATATTTCATAGGTTAAAAAATTCAGCAAAAAATT
CAAAAAAAAGAGGCTTTTTTTGTTTTATCGATGAGCTTAAAGATTTTTTAATGGACGAAAATATGAGAGA
AAGCATACTTGAAAGTATTCTTGAAGTAAGAAAAATAGGTGGAGTAATGTGTATGGGTTTTCAAAACTTA
AGCTTTTTTGATGATATTCCAAAGGGTGCAAGCTTTTTAGAAAATATAGCAAACTATATTATTTTTCCAA
CAACGAACGCACAAACGCTTGAAAATATGAGAAATAAGCTTAATTTAACACCGACAGAGCTTAAATTTTT
GCAAGAAGCAGGAACAAATTCAAGGCAAGTTTTATTAAAAATGAACCTGTCAAATCAATCGGCTATTTTA
AATATAGATCTTAGTCGTTTAGGAAAGCATTTAAGAGTATTCTCATCATCAAGCGATAATGTAATGCTTA
TGAAGGAGCTTAAAGAACTTTATCCAAACGATTGGAGAAATATGTATCTTGAAAATCAAAAACCAAATTT
AAATCAAGGAGCTAAATAA
 Primer design