SecReT4
Protein ID: 32469877
T4SS name [ID]Cjp [603]
Gene symbolCjp54
Locus tagpVir_p54
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pVir (NC_005012)
Repliconplasmid pVir [GenBank: NC_005012] [Browse all T4SS(s) in this replicon]
Location [Strand]37325..37453 [+]
ProductVirB7
Component typeCjp54
UniProt IDQ8GJA1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|32469877|ref|NP_863349.1| VirB7 [Campylobacter jejuni subsp. jejuni 81-176]
MKILKISILTITIIFFSACATTNKEIPKKSPCACNYDVIKIS
 
Nucleotide Sequence: 129 bp     [Download]
>gi|32469825|ref|NC_005012.1|:37325-37453 Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence
ATGAAAATTTTAAAAATAAGTATTTTAACAATAACTATTATTTTTTTTAGTGCGTGTGCAACCACCAATA
AAGAAATTCCTAAAAAATCGCCGTGTGCGTGCAATTATGATGTAATTAAAATTAGTTAA
 Primer design