SecReT4
Protein ID: 32469947
T4SS name [ID]VirB [384]
Gene symboltraB
Locus tagpDTG1p71
StrainPseudomonas putida plasmid pDTG1 (NC_004999)
Repliconplasmid pDTG1 [GenBank: NC_004999] [Browse all T4SS(s) in this replicon]
Location [Strand]64674..66230 [+]
Productputative TraB protein
Component typeVirD4
UniProt IDQ847F1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4e-124, Aligned region: 125..499
TraG-D_C [PF12696], Evalue: 2.2e-20, Aligned region: 363..480
T4SS-DNA_transf [PF02534], Evalue: 3.7e-18, Aligned region: 284..487
AAA_10 [PF12846], Evalue: 4.3e-10, Aligned region: 139..185
Protein Sequence: 518 a.a.     [Download]
>gi|32469947|ref|NP_863124.1| putative TraB protein [Pseudomonas putida]
MHKREVDSAVMTAGFGLPIAGWAAGVYLAQMPLTPFPAAFKETLHNGWQNPIVLGATIATSAVAASLVYY
LYEYCDDGFRGEQYQEFLRGSEIKNWHTVKAKVRRRNEKTNRERKKRGLAKSEPVMIGKLPMPLHLEDRN
TMICASIGAGKSVTMEGMIASALKRGDRMAVVDPNGTFYSKFSFKGDYILNPFDARSAGWTIFNEIRGIH
DFNRMAKSIIPPQVDPSDEQWCAYARDVLSDTMRKLKETNNPNQDTLVNLLVREDGDTIRAFLANTDSEG
YFRDNAEKAIASIQFMMNKYIRPLRYMSKGDFSIYQWVNDPNAGNLFITWREDMRDTMKPLVATWIDTIC
ATILSSEPMTGKRLWLFLDELQSLGKLESFVPAATKGRKHGLRMVGSLQDWSQLNASYGRDDAETLLSCF
RNYVILAAANAKNAGMASEILGSHDVKRWRKSYTAGKLTRTEEVTRDEPVVQASEISNLPDLVAYVKFGE
DFPITKVKTPYIDYKERAQAIMITGQAA
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|32469878|ref|NC_004999.1|:64674-66230 Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence
ATGCATAAAAGAGAAGTCGATTCTGCAGTGATGACAGCGGGTTTCGGTTTGCCGATCGCTGGATGGGCAG
CAGGCGTTTATTTGGCACAGATGCCGTTGACGCCATTCCCTGCAGCGTTCAAGGAAACGCTTCACAACGG
CTGGCAGAACCCGATTGTACTGGGGGCCACAATTGCCACGTCAGCGGTCGCCGCTTCGCTGGTTTATTAC
CTGTACGAGTATTGTGACGATGGGTTCCGGGGCGAGCAGTACCAGGAATTTTTGCGGGGCTCGGAGATAA
AAAACTGGCATACCGTCAAGGCAAAGGTGCGCCGCCGTAACGAGAAGACGAATCGCGAGCGGAAAAAGCG
AGGGTTGGCCAAGTCTGAGCCGGTCATGATTGGCAAGCTGCCTATGCCTCTGCACCTTGAAGATCGAAAC
ACGATGATCTGCGCGTCTATCGGTGCCGGTAAGTCGGTGACCATGGAAGGCATGATCGCCTCGGCATTGA
AGCGTGGTGATCGCATGGCCGTTGTCGACCCAAACGGCACGTTCTATTCGAAATTCAGTTTCAAAGGCGA
TTACATTCTCAACCCATTCGACGCCCGCTCCGCTGGCTGGACCATCTTCAACGAGATCCGTGGCATCCAT
GACTTCAACCGGATGGCCAAGTCGATAATCCCGCCCCAGGTCGACCCGAGTGACGAGCAATGGTGCGCGT
ACGCTCGCGACGTATTGTCCGACACCATGCGCAAGCTGAAAGAAACCAACAACCCGAACCAAGACACGCT
GGTGAATTTGCTGGTGCGGGAGGATGGCGACACCATCCGCGCTTTCCTGGCCAACACGGACTCCGAGGGC
TACTTCCGCGACAACGCAGAGAAGGCAATCGCCAGCATCCAGTTCATGATGAACAAATACATTCGTCCGC
TGCGCTACATGAGCAAGGGCGATTTTTCCATCTACCAATGGGTGAACGATCCTAATGCCGGCAATCTGTT
CATCACTTGGCGGGAGGACATGCGGGACACCATGAAACCACTGGTGGCCACGTGGATTGACACCATCTGT
GCAACGATCCTCAGCTCAGAGCCGATGACAGGCAAACGGCTATGGCTGTTCCTCGACGAGCTGCAGTCCC
TCGGCAAACTGGAAAGCTTCGTTCCTGCGGCGACCAAAGGGCGGAAACATGGTCTGCGTATGGTCGGCAG
CCTGCAGGATTGGTCGCAACTCAACGCCAGTTATGGCCGTGACGATGCGGAAACGCTGCTTTCGTGCTTC
CGAAATTACGTCATTCTTGCTGCAGCGAACGCCAAGAACGCAGGCATGGCCAGCGAAATCCTCGGCTCTC
ACGATGTTAAGCGTTGGCGGAAATCCTACACCGCGGGCAAGTTGACCAGGACCGAGGAAGTCACGCGGGA
TGAGCCGGTGGTTCAGGCTTCTGAAATCTCCAACCTTCCAGATCTGGTCGCCTACGTGAAATTCGGTGAA
GACTTCCCGATCACCAAGGTAAAGACGCCGTACATTGATTACAAAGAGCGCGCCCAGGCAATCATGATAA
CCGGTCAAGCCGCGTAA
 Primer design