SecReT4
Protein ID: 32469955
T4SS name [ID]VirB [384]
Gene symbolmpfI
Locus tagpDTG1p79
StrainPseudomonas putida plasmid pDTG1 (NC_004999)
Repliconplasmid pDTG1 [GenBank: NC_004999] [Browse all T4SS(s) in this replicon]
Location [Strand]73199..74227 [-]
Productputative mating pair formation protein
Component typeVirB11
UniProt IDQ847E3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.6e-59, Aligned region: 15..322
Protein Sequence: 342 a.a.     [Download]
>gi|32469955|ref|NP_863132.1| putative mating pair formation protein [Pseudomonas putida]
MSEIASFRQKLRSFDFLLDDPAVSEIAINGPGNVWAAYRGSRFMRPVVVDGVTLPLIKSLAELIAAHTEQ
EVNAYAPILSGRIPMDMSDHVADSERGDYRVQCVLAPAVEQHIGGIVCIRKPGRVQLTMDQYIASGAFDQ
INEARTPDQYSDDHLVELYRAKRWSEFFIGCVKAHKNIMISAGTNAGKSTFLNMLLQHVDPNERIVTIED
TREIRLKSENVVHLIYSRGGQGKARVTPFDHLESILRLTPDRAIMGELRGAEAYPYLELLNTGHSGSFST
IHSDSPDLMFDRLASMASRGGSDMTKNQLVEFSRHLIDVVIQWEYGFDGRRFITEVQYAKAA
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|32469878|ref|NC_004999.1|:c74227-73199 Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence
ATGTCTGAGATTGCTTCGTTCCGCCAAAAGCTGCGCAGTTTTGATTTCCTGCTCGATGACCCAGCGGTAT
CCGAGATCGCTATTAATGGTCCAGGCAACGTATGGGCCGCGTATCGCGGTAGCCGGTTCATGCGCCCAGT
CGTTGTGGATGGCGTCACCCTTCCGCTGATCAAGTCGCTGGCCGAGTTGATTGCGGCGCATACAGAGCAA
GAGGTCAACGCTTATGCGCCGATCCTGTCCGGTCGCATCCCTATGGACATGAGCGACCACGTAGCGGACT
CGGAACGTGGCGACTATCGGGTCCAGTGCGTGCTTGCGCCTGCCGTTGAGCAACATATCGGCGGCATCGT
CTGTATTCGTAAACCTGGCCGCGTTCAGCTGACGATGGACCAATACATCGCTTCGGGAGCGTTTGACCAG
ATCAACGAGGCACGCACGCCAGATCAGTACAGCGATGATCACCTGGTCGAGTTGTACCGCGCCAAGCGCT
GGTCGGAATTTTTCATTGGGTGCGTCAAGGCCCACAAAAACATCATGATTTCGGCAGGGACAAACGCGGG
CAAAAGCACCTTCCTCAACATGCTGTTGCAGCATGTAGACCCTAATGAGCGGATCGTCACAATCGAAGAT
ACCCGCGAGATCCGTCTCAAAAGCGAGAACGTGGTTCATTTGATCTATTCCCGTGGTGGCCAAGGCAAAG
CGCGGGTCACGCCGTTTGATCACCTTGAGTCGATTCTTCGTCTTACGCCTGACCGCGCAATCATGGGCGA
GCTTCGCGGTGCTGAGGCTTACCCCTATCTTGAATTGCTGAACACCGGCCATAGCGGTTCATTCAGCACT
ATCCACTCGGACAGCCCCGACCTGATGTTTGACCGGCTTGCGTCGATGGCATCGCGTGGCGGCTCTGACA
TGACCAAAAACCAACTTGTGGAATTCTCACGTCACCTGATCGACGTAGTGATCCAGTGGGAATACGGCTT
TGATGGCCGTCGTTTCATCACGGAGGTGCAATATGCAAAAGCTGCCTAA
 Primer design