SecReT4
Protein ID: 32469958
T4SS name [ID]VirB [384]
Gene symbolmpfF
Locus tagpDTG1p82
StrainPseudomonas putida plasmid pDTG1 (NC_004999)
Repliconplasmid pDTG1 [GenBank: NC_004999] [Browse all T4SS(s) in this replicon]
Location [Strand]76339..77004 [-]
Productputative mating pair formation protein
Component typeVirB8
UniProt IDQ847E0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.7e-41, Aligned region: 12..217
Protein Sequence: 221 a.a.     [Download]
>gi|32469958|ref|NP_863135.1| putative mating pair formation protein [Pseudomonas putida]
MDKTLKKDEIARRQRQLEHKKVKQERNRSYFLNGAFALALVGSTIAIAFLAETKTFVNVVTVIGADNEVL
KQRTVTAENVDKEQAVIEGVLFDFIRACNTFDPRRKQQLSDTCHTYMTRNVAVEYEKEISPDNARNPYAS
LGENDWIEAQPKRMNKIGDEYQVIFISTNHKWGDKEPRVTSYLATIKVAHTMIPRALGDRWENPFGTLAT
LYRKSEELSRQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|32469878|ref|NC_004999.1|:c77004-76339 Pseudomonas putida NCIB 9816-4 plasmid pDTG1, complete sequence
ATGGACAAGACATTAAAGAAAGATGAGATTGCGCGCCGTCAGCGTCAACTCGAACACAAGAAGGTAAAAC
AAGAACGTAACCGTAGTTACTTTCTGAACGGTGCCTTCGCACTAGCCCTGGTGGGGTCGACCATAGCCAT
CGCGTTCCTGGCTGAAACAAAGACGTTCGTCAATGTGGTGACGGTGATCGGCGCCGATAATGAAGTGCTC
AAGCAGCGCACGGTTACGGCGGAAAACGTCGACAAAGAGCAGGCTGTCATCGAAGGCGTTCTGTTTGATT
TCATTCGTGCTTGTAACACCTTTGACCCTCGGCGCAAGCAACAGCTGTCCGATACCTGCCACACGTACAT
GACCCGCAATGTCGCTGTCGAATATGAGAAGGAGATCAGCCCCGATAACGCGCGCAATCCATACGCATCG
CTCGGGGAAAACGACTGGATCGAAGCCCAACCCAAGCGCATGAACAAGATTGGCGATGAGTATCAGGTGA
TATTCATTTCAACCAATCACAAGTGGGGTGACAAAGAGCCAAGGGTTACTTCCTACCTGGCAACTATAAA
GGTTGCACACACGATGATCCCTAGAGCCTTGGGTGATCGTTGGGAAAACCCGTTTGGCACCTTGGCAACT
TTATACCGTAAGAGTGAAGAACTGAGCCGCCAGTAA
 Primer design