SecReT4
Protein ID: 32469976
T4SS name [ID]Tra_F [104]
Gene symbolorf3
Locus tagp165897_003
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]1541..2050 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDQ7B3X1, P17738
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|32469976|ref|NP_862915.1| lytic transglycosylase [Escherichia coli]
MKKWMLAICLMFINEICQATDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVTWEAVGAYNAGFRKSERQNQRRLAYASEVYR
IYTGIKSSKGIRLPATKKSLPEINSVQNN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|32469973|ref|NC_004998.1|:c2050-1541 Escherichia coli plasmid p1658/97, complete sequence
ATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGATCTGCCAGGCCACTGATTGCTTTG
ATCTTGCAGGCCGGGATTACAAAATAGATCCTGATTTACTGAGAGCAATATCATGGAAAGAATCCCGTTA
CCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAG
CATTTTAACGAACTGGCCCGCTACGGAATTAAGCCAGAACATCTGACAACAGATCCCTGCATGAACATTT
ATACCGGTGCTTATTATCTGGCAATAGCATTTAAAAAATGGGGCGTCACCTGGGAGGCCGTTGGTGCATA
CAATGCAGGATTCAGGAAATCCGAACGCCAGAACCAGAGACGTCTTGCCTACGCATCAGAGGTTTACCGG
ATTTATACCGGGATAAAAAGCAGTAAAGGTATCCGGCTTCCGGCCACGAAGAAATCACTTCCGGAAATTA
ACAGCGTGCAGAATAATTAA
 Primer design