SecReT4
Protein ID: 32469977
T4SS name [ID]Tra_F [104]
Gene symboltraM
Locus tagp165897_004
StrainEscherichia coli plasmid p1658/97 (NC_004998)
Repliconplasmid p1658/97 [GenBank: NC_004998] [Browse all T4SS(s) in this replicon]
Location [Strand]2464..2847 [+]
Productconjugal transfer protein TraM
Component typeTraM_F
UniProt IDQ84A34, B7LI62
KEGG IDecz:pECS88_0063
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 1e-59, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|32469977|ref|NP_862916.1| conjugal transfer protein TraM [Escherichia coli]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|32469973|ref|NC_004998.1|:2464-2847 Escherichia coli plasmid p1658/97, complete sequence
ATGGCTAAGGTGAACCTGTATATCAGCAATGATGCCTATGAAAAAATAAATGCGATTATTGAGAAGCGTC
GACAGGAAGGGGCAAGGGAAAAAGATGTCAGTTTTTCAGCAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTACATGAGGCTCAGATGGAGCGTAAAGAGTCTGCATTTAATCAGACTGAGTTTAATAAATTGCTT
CTTGAATGCGTTGTAAAAACACAATCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTCAGTCCTCATG
TCTCCGGAAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATCAGGGAGAAGGTATCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGATGAATAA
 Primer design